Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 14323..14749 | Replicon | plasmid unnamed1 |
Accession | NZ_CP027222 | ||
Organism | Escherichia coli strain 2015C-3101 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C6H98_RS28360 | Protein ID | WP_001312861.1 |
Coordinates | 14323..14481 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 14525..14749 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6H98_RS28320 | 9693..10382 | - | 690 | WP_000283394.1 | conjugal transfer transcriptional regulator TraJ | - |
C6H98_RS28325 | 10569..10952 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
C6H98_RS28330 | 11366..11875 | + | 510 | Protein_14 | transglycosylase SLT domain-containing protein | - |
C6H98_RS28335 | 12172..12993 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
C6H98_RS28340 | 13113..13401 | - | 289 | Protein_16 | hypothetical protein | - |
C6H98_RS29715 | 13745..13969 | + | 225 | WP_001427866.1 | hypothetical protein | - |
C6H98_RS28360 | 14323..14481 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 14525..14749 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 14525..14749 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 14525..14749 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 14525..14749 | - | 225 | NuclAT_0 | - | Antitoxin |
C6H98_RS29450 | 14561..14749 | + | 189 | WP_001299721.1 | hypothetical protein | - |
C6H98_RS28365 | 14761..15480 | - | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
C6H98_RS28370 | 15477..15911 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
C6H98_RS28375 | 15966..17924 | - | 1959 | WP_001145472.1 | ParB/RepB/Spo0J family partition protein | - |
C6H98_RS28380 | 17983..18216 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
C6H98_RS28385 | 18272..18799 | - | 528 | WP_000290792.1 | single-stranded DNA-binding protein | - |
C6H98_RS28400 | 19144..19368 | + | 225 | WP_001427866.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyC / hlyA / hlyB / hlyD / hlyD | 1..48390 | 48390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T97700 WP_001312861.1 NZ_CP027222:c14481-14323 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T97700 NZ_CP027222:c14481-14323 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT97700 NZ_CP027222:c14749-14525 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|