Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2715428..2715648 Replicon chromosome
Accession NZ_CP027219
Organism Escherichia coli strain 2015C-3163

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag C6H73_RS14715 Protein ID WP_000170965.1
Coordinates 2715541..2715648 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2715428..2715494 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H73_RS14685 2710707..2712101 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
C6H73_RS14690 2712286..2712639 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
C6H73_RS14695 2712683..2713378 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C6H73_RS14700 2713536..2713766 - 231 WP_001146442.1 putative cation transport regulator ChaB -
C6H73_RS14705 2714036..2715136 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2715428..2715494 - 67 - - Antitoxin
C6H73_RS14715 2715541..2715648 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2715961..2716024 - 64 NuclAT_33 - -
- 2715961..2716024 - 64 NuclAT_33 - -
- 2715961..2716024 - 64 NuclAT_33 - -
- 2715961..2716024 - 64 NuclAT_33 - -
- 2715961..2716024 - 64 NuclAT_35 - -
- 2715961..2716024 - 64 NuclAT_35 - -
- 2715961..2716024 - 64 NuclAT_35 - -
- 2715961..2716024 - 64 NuclAT_35 - -
- 2715961..2716024 - 64 NuclAT_37 - -
- 2715961..2716024 - 64 NuclAT_37 - -
- 2715961..2716024 - 64 NuclAT_37 - -
- 2715961..2716024 - 64 NuclAT_37 - -
- 2715961..2716024 - 64 NuclAT_39 - -
- 2715961..2716024 - 64 NuclAT_39 - -
- 2715961..2716024 - 64 NuclAT_39 - -
- 2715961..2716024 - 64 NuclAT_39 - -
- 2715961..2716024 - 64 NuclAT_41 - -
- 2715961..2716024 - 64 NuclAT_41 - -
- 2715961..2716024 - 64 NuclAT_41 - -
- 2715961..2716024 - 64 NuclAT_41 - -
- 2715961..2716024 - 64 NuclAT_43 - -
- 2715961..2716024 - 64 NuclAT_43 - -
- 2715961..2716024 - 64 NuclAT_43 - -
- 2715961..2716024 - 64 NuclAT_43 - -
- 2715962..2716024 - 63 NuclAT_45 - -
- 2715962..2716024 - 63 NuclAT_45 - -
- 2715962..2716024 - 63 NuclAT_45 - -
- 2715962..2716024 - 63 NuclAT_45 - -
- 2715962..2716024 - 63 NuclAT_48 - -
- 2715962..2716024 - 63 NuclAT_48 - -
- 2715962..2716024 - 63 NuclAT_48 - -
- 2715962..2716024 - 63 NuclAT_48 - -
- 2715963..2716024 - 62 NuclAT_15 - -
- 2715963..2716024 - 62 NuclAT_15 - -
- 2715963..2716024 - 62 NuclAT_15 - -
- 2715963..2716024 - 62 NuclAT_15 - -
- 2715963..2716024 - 62 NuclAT_18 - -
- 2715963..2716024 - 62 NuclAT_18 - -
- 2715963..2716024 - 62 NuclAT_18 - -
- 2715963..2716024 - 62 NuclAT_18 - -
- 2715963..2716024 - 62 NuclAT_21 - -
- 2715963..2716024 - 62 NuclAT_21 - -
- 2715963..2716024 - 62 NuclAT_21 - -
- 2715963..2716024 - 62 NuclAT_21 - -
- 2715963..2716024 - 62 NuclAT_24 - -
- 2715963..2716024 - 62 NuclAT_24 - -
- 2715963..2716024 - 62 NuclAT_24 - -
- 2715963..2716024 - 62 NuclAT_24 - -
- 2715963..2716024 - 62 NuclAT_27 - -
- 2715963..2716024 - 62 NuclAT_27 - -
- 2715963..2716024 - 62 NuclAT_27 - -
- 2715963..2716024 - 62 NuclAT_27 - -
- 2715963..2716024 - 62 NuclAT_30 - -
- 2715963..2716024 - 62 NuclAT_30 - -
- 2715963..2716024 - 62 NuclAT_30 - -
- 2715963..2716024 - 62 NuclAT_30 - -
C6H73_RS14720 2716077..2716184 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2716498..2716564 - 67 NuclAT_44 - -
- 2716498..2716564 - 67 NuclAT_44 - -
- 2716498..2716564 - 67 NuclAT_44 - -
- 2716498..2716564 - 67 NuclAT_44 - -
- 2716498..2716564 - 67 NuclAT_47 - -
- 2716498..2716564 - 67 NuclAT_47 - -
- 2716498..2716564 - 67 NuclAT_47 - -
- 2716498..2716564 - 67 NuclAT_47 - -
- 2716499..2716562 - 64 NuclAT_16 - -
- 2716499..2716562 - 64 NuclAT_16 - -
- 2716499..2716562 - 64 NuclAT_16 - -
- 2716499..2716562 - 64 NuclAT_16 - -
- 2716499..2716562 - 64 NuclAT_19 - -
- 2716499..2716562 - 64 NuclAT_19 - -
- 2716499..2716562 - 64 NuclAT_19 - -
- 2716499..2716562 - 64 NuclAT_19 - -
- 2716499..2716562 - 64 NuclAT_22 - -
- 2716499..2716562 - 64 NuclAT_22 - -
- 2716499..2716562 - 64 NuclAT_22 - -
- 2716499..2716562 - 64 NuclAT_22 - -
- 2716499..2716562 - 64 NuclAT_25 - -
- 2716499..2716562 - 64 NuclAT_25 - -
- 2716499..2716562 - 64 NuclAT_25 - -
- 2716499..2716562 - 64 NuclAT_25 - -
- 2716499..2716562 - 64 NuclAT_28 - -
- 2716499..2716562 - 64 NuclAT_28 - -
- 2716499..2716562 - 64 NuclAT_28 - -
- 2716499..2716562 - 64 NuclAT_28 - -
- 2716499..2716562 - 64 NuclAT_31 - -
- 2716499..2716562 - 64 NuclAT_31 - -
- 2716499..2716562 - 64 NuclAT_31 - -
- 2716499..2716562 - 64 NuclAT_31 - -
C6H73_RS14725 2716612..2716719 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
C6H73_RS14730 2716868..2717722 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6H73_RS14735 2717758..2718567 - 810 WP_001257037.1 invasion regulator SirB1 -
C6H73_RS14740 2718571..2718963 - 393 WP_000200392.1 invasion regulator SirB2 -
C6H73_RS14745 2718960..2719793 - 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T97658 WP_000170965.1 NZ_CP027219:2715541-2715648 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T97658 NZ_CP027219:2715541-2715648 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT97658 NZ_CP027219:c2715494-2715428 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References