Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 121419..121652 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP027130 | ||
| Organism | Escherichia coli strain AR_0372 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CSC09_RS00870 | Protein ID | WP_001312861.1 |
| Coordinates | 121419..121577 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 121621..121652 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC09_RS00835 | 116793..117482 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| CSC09_RS00840 | 117669..118052 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| CSC09_RS00845 | 118373..118975 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| CSC09_RS00850 | 119272..120093 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| CSC09_RS00855 | 120211..120498 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| CSC09_RS00870 | 121419..121577 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 121621..121652 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 121621..121652 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 121621..121652 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 121621..121652 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 123094..123291 | - | 198 | NuclAT_0 | - | - |
| - | 123094..123291 | - | 198 | NuclAT_0 | - | - |
| - | 123094..123291 | - | 198 | NuclAT_0 | - | - |
| - | 123094..123291 | - | 198 | NuclAT_0 | - | - |
| CSC09_RS29155 | 123103..123291 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| CSC09_RS00880 | 123303..124022 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| CSC09_RS00885 | 124019..124453 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| CSC09_RS00890 | 124508..124705 | - | 198 | Protein_150 | hypothetical protein | - |
| CSC09_RS00895 | 124733..124966 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| CSC09_RS00900 | 125034..125573 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| CSC09_RS29355 | 125599..125805 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| CSC09_RS00915 | 126215..126421 | - | 207 | WP_001774176.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..170292 | 170292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T97393 WP_001312861.1 NZ_CP027130:c121577-121419 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T97393 NZ_CP027130:c121577-121419 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT97393 NZ_CP027130:c121652-121621 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|