Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 65722..65991 | Replicon | plasmid pRM14721 |
Accession | NZ_CP027106 | ||
Organism | Escherichia coli strain RM14721 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C5097_RS24715 | Protein ID | WP_001312861.1 |
Coordinates | 65833..65991 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 65722..65787 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5097_RS24685 | 61021..61818 | + | 798 | WP_123001400.1 | IS21-like element IS21 family helper ATPase IstB | - |
C5097_RS24690 | 61937..63298 | + | 1362 | WP_106668545.1 | DUF3560 domain-containing protein | - |
C5097_RS24695 | 63346..63609 | + | 264 | Protein_66 | class I SAM-dependent methyltransferase | - |
C5097_RS24700 | 63644..64348 | + | 705 | WP_199796835.1 | chromosome partitioning protein ParB | - |
C5097_RS24705 | 64403..64837 | + | 435 | WP_096115306.1 | conjugation system SOS inhibitor PsiB | - |
C5097_RS24710 | 64834..65553 | + | 720 | WP_106668546.1 | plasmid SOS inhibition protein A | - |
C5097_RS25255 | 65565..65753 | - | 189 | WP_032189914.1 | hypothetical protein | - |
- | 65565..65789 | + | 225 | NuclAT_0 | - | - |
- | 65565..65789 | + | 225 | NuclAT_0 | - | - |
- | 65565..65789 | + | 225 | NuclAT_0 | - | - |
- | 65565..65789 | + | 225 | NuclAT_0 | - | - |
- | 65722..65787 | + | 66 | - | - | Antitoxin |
C5097_RS24715 | 65833..65991 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C5097_RS25380 | 66226..66405 | - | 180 | Protein_72 | pilus assembly protein | - |
C5097_RS25385 | 66654..66845 | + | 192 | Protein_73 | single-stranded DNA-binding protein | - |
C5097_RS24740 | 67008..68012 | - | 1005 | WP_024186362.1 | IS110 family transposase | - |
C5097_RS24750 | 68404..69423 | + | 1020 | WP_053901803.1 | IS110-like element ISEc66 family transposase | - |
C5097_RS24760 | 69720..70217 | + | 498 | Protein_76 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | cofA | 1..106432 | 106432 | |
- | flank | IS/Tn | - | - | 68404..69423 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T97289 WP_001312861.1 NZ_CP027106:65833-65991 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T97289 NZ_CP027106:65833-65991 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT97289 NZ_CP027106:65722-65787 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|