Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1744060..1744240 | Replicon | chromosome |
| Accession | NZ_CP026968 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK60_RS14970 | Protein ID | WP_001801861.1 |
| Coordinates | 1744060..1744155 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1744183..1744240 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK60_RS08895 | 1739223..1739873 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| RK60_RS08900 | 1739954..1740949 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| RK60_RS08905 | 1741024..1741650 | + | 627 | WP_016170738.1 | hypothetical protein | - |
| RK60_RS08910 | 1741691..1742032 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| RK60_RS08915 | 1742133..1742705 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| RK60_RS08920 | 1742903..1743915 | - | 1013 | Protein_1680 | IS3 family transposase | - |
| RK60_RS14970 | 1744060..1744155 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1744183..1744240 | - | 58 | - | - | Antitoxin |
| RK60_RS08925 | 1744278..1744379 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| RK60_RS08930 | 1744357..1744518 | - | 162 | Protein_1683 | transposase | - |
| RK60_RS08935 | 1744509..1745003 | - | 495 | Protein_1684 | transposase | - |
| RK60_RS08940 | 1745455..1746684 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| RK60_RS08945 | 1746677..1748233 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| RK60_RS08950 | 1748397..1748531 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1720436..1771072 | 50636 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96898 WP_001801861.1 NZ_CP026968:1744060-1744155 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96898 NZ_CP026968:1744060-1744155 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT96898 NZ_CP026968:c1744240-1744183 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|