Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1689354..1689536 | Replicon | chromosome |
| Accession | NZ_CP026964 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK61_RS14600 | Protein ID | WP_001801861.1 |
| Coordinates | 1689441..1689536 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1689354..1689413 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK61_RS08850 | 1688492..1688869 | + | 378 | Protein_1604 | DUF1433 domain-containing protein | - |
| RK61_RS08855 | 1689063..1689239 | + | 177 | Protein_1605 | transposase | - |
| RK61_RS08860 | 1689217..1689318 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 1689354..1689413 | + | 60 | - | - | Antitoxin |
| RK61_RS14600 | 1689441..1689536 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK61_RS08870 | 1689739..1689882 | + | 144 | WP_001549059.1 | transposase | - |
| RK61_RS08880 | 1690486..1690869 | + | 384 | WP_000070814.1 | hypothetical protein | - |
| RK61_RS08885 | 1690880..1691056 | + | 177 | WP_000375477.1 | hypothetical protein | - |
| RK61_RS08895 | 1691430..1691987 | + | 558 | Protein_1611 | ImmA/IrrE family metallo-endopeptidase | - |
| RK61_RS08900 | 1692185..1692757 | - | 573 | WP_000414202.1 | hypothetical protein | - |
| RK61_RS08905 | 1692858..1693199 | - | 342 | WP_000627541.1 | DUF3969 family protein | - |
| RK61_RS08910 | 1693240..1693866 | - | 627 | WP_000669017.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1672579..1696424 | 23845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96890 WP_001801861.1 NZ_CP026964:c1689536-1689441 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96890 NZ_CP026964:c1689536-1689441 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT96890 NZ_CP026964:1689354-1689413 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|