Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1217937..1218119 | Replicon | chromosome |
Accession | NZ_CP026960 | ||
Organism | Staphylococcus aureus strain FDAARGOS_15 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK73_RS14695 | Protein ID | WP_001801861.1 |
Coordinates | 1217937..1218032 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1218060..1218119 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK73_RS06165 | 1213597..1214223 | + | 627 | WP_000669046.1 | hypothetical protein | - |
RK73_RS06170 | 1214264..1214608 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
RK73_RS06175 | 1214706..1215257 | + | 552 | WP_000414205.1 | hypothetical protein | - |
RK73_RS06180 | 1215475..1216116 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
RK73_RS06185 | 1216230..1216415 | - | 186 | WP_000809857.1 | hypothetical protein | - |
RK73_RS06190 | 1216417..1216593 | - | 177 | WP_000375476.1 | hypothetical protein | - |
RK73_RS06195 | 1216604..1216987 | - | 384 | WP_000070812.1 | hypothetical protein | - |
RK73_RS06205 | 1217591..1217734 | - | 144 | WP_001549059.1 | transposase | - |
RK73_RS14695 | 1217937..1218032 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1218060..1218119 | - | 60 | - | - | Antitoxin |
RK73_RS06215 | 1218155..1218256 | + | 102 | WP_001791893.1 | hypothetical protein | - |
RK73_RS06220 | 1218234..1218410 | - | 177 | Protein_1192 | transposase | - |
RK73_RS06225 | 1218604..1218981 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1211037..1236638 | 25601 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96835 WP_001801861.1 NZ_CP026960:1217937-1218032 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96835 NZ_CP026960:1217937-1218032 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT96835 NZ_CP026960:c1218119-1218060 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|