Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1520452..1520636 | Replicon | chromosome |
Accession | NZ_CP026958 | ||
Organism | Staphylococcus aureus strain FDAARGOS_40 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | RK98_RS07900 | Protein ID | WP_000482652.1 |
Coordinates | 1520452..1520559 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1520576..1520636 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK98_RS07875 | 1515814..1516287 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
RK98_RS07880 | 1516410..1517621 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
RK98_RS07885 | 1517803..1518462 | - | 660 | WP_000831298.1 | membrane protein | - |
RK98_RS07890 | 1518522..1519664 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
RK98_RS07895 | 1519932..1520318 | + | 387 | WP_000779360.1 | flippase GtxA | - |
RK98_RS07900 | 1520452..1520559 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1520576..1520636 | - | 61 | - | - | Antitoxin |
RK98_RS07910 | 1521262..1523025 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
RK98_RS07915 | 1523050..1524783 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
RK98_RS07925 | 1525014..1525181 | + | 168 | Protein_1448 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T96823 WP_000482652.1 NZ_CP026958:1520452-1520559 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T96823 NZ_CP026958:1520452-1520559 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT96823 NZ_CP026958:c1520636-1520576 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|