Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 121940..122120 | Replicon | chromosome |
| Accession | NZ_CP026958 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_40 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK98_RS15130 | Protein ID | WP_001801861.1 |
| Coordinates | 121940..122035 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 122063..122120 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK98_RS00540 | 117103..117753 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| RK98_RS00545 | 117834..118829 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| RK98_RS00550 | 118904..119530 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| RK98_RS00555 | 119571..119912 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| RK98_RS00560 | 120013..120585 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| RK98_RS00565 | 120783..121795 | - | 1013 | Protein_109 | IS3 family transposase | - |
| RK98_RS15130 | 121940..122035 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK98_RS00570 | 122158..122259 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| RK98_RS00575 | 122237..122398 | - | 162 | Protein_112 | transposase | - |
| RK98_RS00580 | 122389..122883 | - | 495 | Protein_113 | transposase | - |
| RK98_RS00585 | 123335..124564 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
| RK98_RS00590 | 124557..126113 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| RK98_RS00595 | 126277..126411 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 116345..168353 | 52008 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96815 WP_001801861.1 NZ_CP026958:121940-122035 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96815 NZ_CP026958:121940-122035 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT96815 NZ_CP026958:c122120-122063 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|