Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2450015..2450199 | Replicon | chromosome |
Accession | NZ_CP026957 | ||
Organism | Staphylococcus aureus strain FDAARGOS_43 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | RL01_RS12595 | Protein ID | WP_000482647.1 |
Coordinates | 2450015..2450122 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2450139..2450199 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RL01_RS12570 | 2445387..2445860 | + | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
RL01_RS12575 | 2445983..2447194 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
RL01_RS12580 | 2447376..2448035 | - | 660 | WP_000831301.1 | membrane protein | - |
RL01_RS12585 | 2448095..2449237 | - | 1143 | WP_001176871.1 | glycerate kinase | - |
RL01_RS12590 | 2449495..2449881 | + | 387 | WP_000779360.1 | flippase GtxA | - |
RL01_RS12595 | 2450015..2450122 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2450139..2450199 | - | 61 | - | - | Antitoxin |
RL01_RS12605 | 2450806..2452569 | + | 1764 | WP_001064815.1 | ABC transporter ATP-binding protein/permease | - |
RL01_RS12610 | 2452594..2454327 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
RL01_RS12620 | 2454558..2454725 | + | 168 | WP_001793334.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T96806 WP_000482647.1 NZ_CP026957:2450015-2450122 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T96806 NZ_CP026957:2450015-2450122 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT96806 NZ_CP026957:c2450199-2450139 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|