Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 240131..240313 | Replicon | chromosome |
Accession | NZ_CP026957 | ||
Organism | Staphylococcus aureus strain FDAARGOS_43 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RL01_RS14625 | Protein ID | WP_001801861.1 |
Coordinates | 240218..240313 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 240131..240190 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RL01_RS01520 | 239269..239646 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
RL01_RS01525 | 239840..240016 | + | 177 | Protein_247 | transposase | - |
RL01_RS01530 | 239994..240095 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 240131..240190 | + | 60 | - | - | Antitoxin |
RL01_RS14625 | 240218..240313 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
RL01_RS01540 | 240516..240659 | + | 144 | WP_001549059.1 | transposase | - |
RL01_RS01550 | 241263..241646 | + | 384 | WP_000070811.1 | hypothetical protein | - |
RL01_RS01555 | 241657..241833 | + | 177 | WP_000375477.1 | hypothetical protein | - |
RL01_RS01565 | 242207..242764 | + | 558 | Protein_253 | ImmA/IrrE family metallo-endopeptidase | - |
RL01_RS01570 | 242962..243534 | - | 573 | WP_000414202.1 | hypothetical protein | - |
RL01_RS01575 | 243635..243976 | - | 342 | WP_000627541.1 | DUF3969 family protein | - |
RL01_RS01580 | 244017..244643 | - | 627 | WP_000669017.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 223355..247201 | 23846 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96797 WP_001801861.1 NZ_CP026957:c240313-240218 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96797 NZ_CP026957:c240313-240218 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT96797 NZ_CP026957:240131-240190 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|