96757

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2762173..2762393 Replicon chromosome
Accession NZ_CP026939
Organism Escherichia coli strain CFS3313

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag C5F74_RS13185 Protein ID WP_000170965.1
Coordinates 2762286..2762393 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2762173..2762239 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C5F74_RS13160 2757452..2758846 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
C5F74_RS13165 2759031..2759384 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
C5F74_RS13170 2759428..2760123 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C5F74_RS13175 2760281..2760511 - 231 WP_001146442.1 putative cation transport regulator ChaB -
C5F74_RS13180 2760781..2761881 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2762173..2762239 - 67 - - Antitoxin
C5F74_RS13185 2762286..2762393 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2762706..2762769 - 64 NuclAT_33 - -
- 2762706..2762769 - 64 NuclAT_33 - -
- 2762706..2762769 - 64 NuclAT_33 - -
- 2762706..2762769 - 64 NuclAT_33 - -
- 2762706..2762769 - 64 NuclAT_36 - -
- 2762706..2762769 - 64 NuclAT_36 - -
- 2762706..2762769 - 64 NuclAT_36 - -
- 2762706..2762769 - 64 NuclAT_36 - -
- 2762706..2762769 - 64 NuclAT_39 - -
- 2762706..2762769 - 64 NuclAT_39 - -
- 2762706..2762769 - 64 NuclAT_39 - -
- 2762706..2762769 - 64 NuclAT_39 - -
- 2762706..2762769 - 64 NuclAT_42 - -
- 2762706..2762769 - 64 NuclAT_42 - -
- 2762706..2762769 - 64 NuclAT_42 - -
- 2762706..2762769 - 64 NuclAT_42 - -
- 2762706..2762769 - 64 NuclAT_45 - -
- 2762706..2762769 - 64 NuclAT_45 - -
- 2762706..2762769 - 64 NuclAT_45 - -
- 2762706..2762769 - 64 NuclAT_45 - -
- 2762706..2762769 - 64 NuclAT_48 - -
- 2762706..2762769 - 64 NuclAT_48 - -
- 2762706..2762769 - 64 NuclAT_48 - -
- 2762706..2762769 - 64 NuclAT_48 - -
- 2762707..2762769 - 63 NuclAT_50 - -
- 2762707..2762769 - 63 NuclAT_50 - -
- 2762707..2762769 - 63 NuclAT_50 - -
- 2762707..2762769 - 63 NuclAT_50 - -
- 2762707..2762769 - 63 NuclAT_53 - -
- 2762707..2762769 - 63 NuclAT_53 - -
- 2762707..2762769 - 63 NuclAT_53 - -
- 2762707..2762769 - 63 NuclAT_53 - -
- 2762707..2762769 - 63 NuclAT_56 - -
- 2762707..2762769 - 63 NuclAT_56 - -
- 2762707..2762769 - 63 NuclAT_56 - -
- 2762707..2762769 - 63 NuclAT_56 - -
- 2762708..2762769 - 62 NuclAT_15 - -
- 2762708..2762769 - 62 NuclAT_15 - -
- 2762708..2762769 - 62 NuclAT_15 - -
- 2762708..2762769 - 62 NuclAT_15 - -
- 2762708..2762769 - 62 NuclAT_18 - -
- 2762708..2762769 - 62 NuclAT_18 - -
- 2762708..2762769 - 62 NuclAT_18 - -
- 2762708..2762769 - 62 NuclAT_18 - -
- 2762708..2762769 - 62 NuclAT_21 - -
- 2762708..2762769 - 62 NuclAT_21 - -
- 2762708..2762769 - 62 NuclAT_21 - -
- 2762708..2762769 - 62 NuclAT_21 - -
- 2762708..2762769 - 62 NuclAT_24 - -
- 2762708..2762769 - 62 NuclAT_24 - -
- 2762708..2762769 - 62 NuclAT_24 - -
- 2762708..2762769 - 62 NuclAT_24 - -
- 2762708..2762769 - 62 NuclAT_27 - -
- 2762708..2762769 - 62 NuclAT_27 - -
- 2762708..2762769 - 62 NuclAT_27 - -
- 2762708..2762769 - 62 NuclAT_27 - -
- 2762708..2762769 - 62 NuclAT_30 - -
- 2762708..2762769 - 62 NuclAT_30 - -
- 2762708..2762769 - 62 NuclAT_30 - -
- 2762708..2762769 - 62 NuclAT_30 - -
C5F74_RS13190 2762822..2762929 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2763242..2763307 - 66 NuclAT_32 - -
- 2763242..2763307 - 66 NuclAT_32 - -
- 2763242..2763307 - 66 NuclAT_32 - -
- 2763242..2763307 - 66 NuclAT_32 - -
- 2763242..2763307 - 66 NuclAT_35 - -
- 2763242..2763307 - 66 NuclAT_35 - -
- 2763242..2763307 - 66 NuclAT_35 - -
- 2763242..2763307 - 66 NuclAT_35 - -
- 2763242..2763307 - 66 NuclAT_38 - -
- 2763242..2763307 - 66 NuclAT_38 - -
- 2763242..2763307 - 66 NuclAT_38 - -
- 2763242..2763307 - 66 NuclAT_38 - -
- 2763242..2763307 - 66 NuclAT_41 - -
- 2763242..2763307 - 66 NuclAT_41 - -
- 2763242..2763307 - 66 NuclAT_41 - -
- 2763242..2763307 - 66 NuclAT_41 - -
- 2763242..2763307 - 66 NuclAT_44 - -
- 2763242..2763307 - 66 NuclAT_44 - -
- 2763242..2763307 - 66 NuclAT_44 - -
- 2763242..2763307 - 66 NuclAT_44 - -
- 2763242..2763307 - 66 NuclAT_47 - -
- 2763242..2763307 - 66 NuclAT_47 - -
- 2763242..2763307 - 66 NuclAT_47 - -
- 2763242..2763307 - 66 NuclAT_47 - -
- 2763243..2763309 - 67 NuclAT_49 - -
- 2763243..2763309 - 67 NuclAT_49 - -
- 2763243..2763309 - 67 NuclAT_49 - -
- 2763243..2763309 - 67 NuclAT_49 - -
- 2763243..2763309 - 67 NuclAT_52 - -
- 2763243..2763309 - 67 NuclAT_52 - -
- 2763243..2763309 - 67 NuclAT_52 - -
- 2763243..2763309 - 67 NuclAT_52 - -
- 2763243..2763309 - 67 NuclAT_55 - -
- 2763243..2763309 - 67 NuclAT_55 - -
- 2763243..2763309 - 67 NuclAT_55 - -
- 2763243..2763309 - 67 NuclAT_55 - -
- 2763244..2763307 - 64 NuclAT_14 - -
- 2763244..2763307 - 64 NuclAT_14 - -
- 2763244..2763307 - 64 NuclAT_14 - -
- 2763244..2763307 - 64 NuclAT_14 - -
- 2763244..2763307 - 64 NuclAT_17 - -
- 2763244..2763307 - 64 NuclAT_17 - -
- 2763244..2763307 - 64 NuclAT_17 - -
- 2763244..2763307 - 64 NuclAT_17 - -
- 2763244..2763307 - 64 NuclAT_20 - -
- 2763244..2763307 - 64 NuclAT_20 - -
- 2763244..2763307 - 64 NuclAT_20 - -
- 2763244..2763307 - 64 NuclAT_20 - -
- 2763244..2763307 - 64 NuclAT_23 - -
- 2763244..2763307 - 64 NuclAT_23 - -
- 2763244..2763307 - 64 NuclAT_23 - -
- 2763244..2763307 - 64 NuclAT_23 - -
- 2763244..2763307 - 64 NuclAT_26 - -
- 2763244..2763307 - 64 NuclAT_26 - -
- 2763244..2763307 - 64 NuclAT_26 - -
- 2763244..2763307 - 64 NuclAT_26 - -
- 2763244..2763307 - 64 NuclAT_29 - -
- 2763244..2763307 - 64 NuclAT_29 - -
- 2763244..2763307 - 64 NuclAT_29 - -
- 2763244..2763307 - 64 NuclAT_29 - -
C5F74_RS13195 2763357..2763464 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
C5F74_RS13200 2763613..2764467 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C5F74_RS13205 2764503..2765312 - 810 WP_001257044.1 invasion regulator SirB1 -
C5F74_RS13210 2765316..2765708 - 393 WP_000200392.1 invasion regulator SirB2 -
C5F74_RS13215 2765705..2766538 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T96757 WP_000170965.1 NZ_CP026939:2762286-2762393 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T96757 NZ_CP026939:2762286-2762393 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT96757 NZ_CP026939:c2762239-2762173 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References