Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2762173..2762393 | Replicon | chromosome |
Accession | NZ_CP026939 | ||
Organism | Escherichia coli strain CFS3313 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | C5F74_RS13185 | Protein ID | WP_000170965.1 |
Coordinates | 2762286..2762393 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2762173..2762239 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5F74_RS13160 | 2757452..2758846 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
C5F74_RS13165 | 2759031..2759384 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
C5F74_RS13170 | 2759428..2760123 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C5F74_RS13175 | 2760281..2760511 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
C5F74_RS13180 | 2760781..2761881 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- | 2762173..2762239 | - | 67 | - | - | Antitoxin |
C5F74_RS13185 | 2762286..2762393 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2762706..2762769 | - | 64 | NuclAT_33 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_33 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_33 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_33 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_36 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_36 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_36 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_36 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_39 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_39 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_39 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_39 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_42 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_42 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_42 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_42 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_45 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_45 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_45 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_45 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_48 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_48 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_48 | - | - |
- | 2762706..2762769 | - | 64 | NuclAT_48 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_50 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_50 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_50 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_50 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_53 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_53 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_53 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_53 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_56 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_56 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_56 | - | - |
- | 2762707..2762769 | - | 63 | NuclAT_56 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_15 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_15 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_15 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_15 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_18 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_18 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_18 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_18 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_21 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_21 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_21 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_21 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_24 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_24 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_24 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_24 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_27 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_27 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_27 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_27 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_30 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_30 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_30 | - | - |
- | 2762708..2762769 | - | 62 | NuclAT_30 | - | - |
C5F74_RS13190 | 2762822..2762929 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 2763242..2763307 | - | 66 | NuclAT_32 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_32 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_32 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_32 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_35 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_35 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_35 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_35 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_38 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_38 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_38 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_38 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_41 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_41 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_41 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_41 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_44 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_44 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_44 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_44 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_47 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_47 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_47 | - | - |
- | 2763242..2763307 | - | 66 | NuclAT_47 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_49 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_49 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_49 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_49 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_52 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_52 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_52 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_52 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_55 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_55 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_55 | - | - |
- | 2763243..2763309 | - | 67 | NuclAT_55 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_14 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_14 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_14 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_14 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_17 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_17 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_17 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_17 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_20 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_20 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_20 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_20 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_23 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_23 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_23 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_23 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_26 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_26 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_26 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_26 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_29 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_29 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_29 | - | - |
- | 2763244..2763307 | - | 64 | NuclAT_29 | - | - |
C5F74_RS13195 | 2763357..2763464 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
C5F74_RS13200 | 2763613..2764467 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C5F74_RS13205 | 2764503..2765312 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
C5F74_RS13210 | 2765316..2765708 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
C5F74_RS13215 | 2765705..2766538 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T96757 WP_000170965.1 NZ_CP026939:2762286-2762393 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T96757 NZ_CP026939:2762286-2762393 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT96757 NZ_CP026939:c2762239-2762173 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|