Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 99702..99935 | Replicon | plasmid pCFS3273-2 |
| Accession | NZ_CP026934 | ||
| Organism | Escherichia coli strain CFS3273 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | C5F73_RS26500 | Protein ID | WP_001312861.1 |
| Coordinates | 99702..99860 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 99904..99935 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5F73_RS26475 | 95075..95764 | - | 690 | WP_000283383.1 | conjugal transfer transcriptional regulator TraJ | - |
| C5F73_RS26480 | 95951..96334 | - | 384 | WP_001151528.1 | relaxosome protein TraM | - |
| C5F73_RS26485 | 96655..97257 | + | 603 | WP_000243710.1 | transglycosylase SLT domain-containing protein | - |
| C5F73_RS26490 | 97554..98375 | - | 822 | WP_001234423.1 | DUF945 domain-containing protein | - |
| C5F73_RS26495 | 98495..98692 | - | 198 | WP_052318758.1 | hypothetical protein | - |
| C5F73_RS26500 | 99702..99860 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 99904..99935 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 99904..99935 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 99904..99935 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 99904..99935 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 101377..101574 | - | 198 | NuclAT_0 | - | - |
| - | 101377..101574 | - | 198 | NuclAT_0 | - | - |
| - | 101377..101574 | - | 198 | NuclAT_0 | - | - |
| - | 101377..101574 | - | 198 | NuclAT_0 | - | - |
| C5F73_RS26510 | 101386..101574 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| C5F73_RS26515 | 101586..102305 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| C5F73_RS26520 | 102302..102736 | - | 435 | WP_000845932.1 | conjugation system SOS inhibitor PsiB | - |
| C5F73_RS26525 | 102791..104749 | - | 1959 | Protein_122 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / sul2 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..145001 | 145001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T96695 WP_001312861.1 NZ_CP026934:c99860-99702 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T96695 NZ_CP026934:c99860-99702 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT96695 NZ_CP026934:c99935-99904 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|