Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3957211..3957433 | Replicon | chromosome |
Accession | NZ_CP026853 | ||
Organism | Escherichia coli strain MS7163 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A0D6GD35 |
Locus tag | MS7163_RS20815 | Protein ID | WP_000170745.1 |
Coordinates | 3957211..3957318 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3957375..3957433 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MS7163_RS20775 | 3952264..3952452 | - | 189 | WP_001063314.1 | YhjR family protein | - |
MS7163_RS20780 | 3952725..3954296 | + | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
MS7163_RS20785 | 3954293..3954484 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
MS7163_RS20790 | 3954481..3956160 | + | 1680 | WP_000191616.1 | cellulose biosynthesis protein BcsG | - |
MS7163_RS20795 | 3956246..3956353 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
MS7163_RS28260 | 3956729..3956836 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
MS7163_RS20815 | 3957211..3957318 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3957375..3957433 | + | 59 | - | - | Antitoxin |
MS7163_RS20825 | 3957794..3959065 | + | 1272 | WP_001332306.1 | amino acid permease | - |
MS7163_RS20830 | 3959095..3960099 | - | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
MS7163_RS20835 | 3960096..3961079 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
MS7163_RS20840 | 3961090..3961992 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3855.68 Da Isoelectric Point: 9.0157
>T96502 WP_000170745.1 NZ_CP026853:c3957318-3957211 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
Download Length: 108 bp
>T96502 NZ_CP026853:c3957318-3957211 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT96502 NZ_CP026853:3957375-3957433 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|