Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1321235..1321456 Replicon chromosome
Accession NZ_CP026853
Organism Escherichia coli strain MS7163

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag MS7163_RS07005 Protein ID WP_000170954.1
Coordinates 1321235..1321342 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1321395..1321456 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MS7163_RS06980 1317080..1318162 + 1083 WP_000804726.1 peptide chain release factor 1 -
MS7163_RS06985 1318162..1318995 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
MS7163_RS06990 1318992..1319384 + 393 WP_000200375.1 invasion regulator SirB2 -
MS7163_RS06995 1319388..1320197 + 810 WP_001257054.1 invasion regulator SirB1 -
MS7163_RS07000 1320233..1321087 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MS7163_RS07005 1321235..1321342 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1321395..1321456 + 62 NuclAT_12 - Antitoxin
- 1321395..1321456 + 62 NuclAT_12 - Antitoxin
- 1321395..1321456 + 62 NuclAT_12 - Antitoxin
- 1321395..1321456 + 62 NuclAT_12 - Antitoxin
- 1321395..1321456 + 62 NuclAT_13 - Antitoxin
- 1321395..1321456 + 62 NuclAT_13 - Antitoxin
- 1321395..1321456 + 62 NuclAT_13 - Antitoxin
- 1321395..1321456 + 62 NuclAT_13 - Antitoxin
- 1321395..1321456 + 62 NuclAT_14 - Antitoxin
- 1321395..1321456 + 62 NuclAT_14 - Antitoxin
- 1321395..1321456 + 62 NuclAT_14 - Antitoxin
- 1321395..1321456 + 62 NuclAT_14 - Antitoxin
- 1321395..1321456 + 62 NuclAT_15 - Antitoxin
- 1321395..1321456 + 62 NuclAT_15 - Antitoxin
- 1321395..1321456 + 62 NuclAT_15 - Antitoxin
- 1321395..1321456 + 62 NuclAT_15 - Antitoxin
- 1321395..1321456 + 62 NuclAT_16 - Antitoxin
- 1321395..1321456 + 62 NuclAT_16 - Antitoxin
- 1321395..1321456 + 62 NuclAT_16 - Antitoxin
- 1321395..1321456 + 62 NuclAT_16 - Antitoxin
- 1321395..1321456 + 62 NuclAT_17 - Antitoxin
- 1321395..1321456 + 62 NuclAT_17 - Antitoxin
- 1321395..1321456 + 62 NuclAT_17 - Antitoxin
- 1321395..1321456 + 62 NuclAT_17 - Antitoxin
- 1321395..1321457 + 63 NuclAT_10 - -
- 1321395..1321457 + 63 NuclAT_10 - -
- 1321395..1321457 + 63 NuclAT_10 - -
- 1321395..1321457 + 63 NuclAT_10 - -
- 1321395..1321457 + 63 NuclAT_11 - -
- 1321395..1321457 + 63 NuclAT_11 - -
- 1321395..1321457 + 63 NuclAT_11 - -
- 1321395..1321457 + 63 NuclAT_11 - -
- 1321395..1321457 + 63 NuclAT_6 - -
- 1321395..1321457 + 63 NuclAT_6 - -
- 1321395..1321457 + 63 NuclAT_6 - -
- 1321395..1321457 + 63 NuclAT_6 - -
- 1321395..1321457 + 63 NuclAT_7 - -
- 1321395..1321457 + 63 NuclAT_7 - -
- 1321395..1321457 + 63 NuclAT_7 - -
- 1321395..1321457 + 63 NuclAT_7 - -
- 1321395..1321457 + 63 NuclAT_8 - -
- 1321395..1321457 + 63 NuclAT_8 - -
- 1321395..1321457 + 63 NuclAT_8 - -
- 1321395..1321457 + 63 NuclAT_8 - -
- 1321395..1321457 + 63 NuclAT_9 - -
- 1321395..1321457 + 63 NuclAT_9 - -
- 1321395..1321457 + 63 NuclAT_9 - -
- 1321395..1321457 + 63 NuclAT_9 - -
- 1321395..1321458 + 64 NuclAT_18 - -
- 1321395..1321458 + 64 NuclAT_18 - -
- 1321395..1321458 + 64 NuclAT_18 - -
- 1321395..1321458 + 64 NuclAT_18 - -
- 1321395..1321458 + 64 NuclAT_19 - -
- 1321395..1321458 + 64 NuclAT_19 - -
- 1321395..1321458 + 64 NuclAT_19 - -
- 1321395..1321458 + 64 NuclAT_19 - -
- 1321395..1321458 + 64 NuclAT_20 - -
- 1321395..1321458 + 64 NuclAT_20 - -
- 1321395..1321458 + 64 NuclAT_20 - -
- 1321395..1321458 + 64 NuclAT_20 - -
- 1321395..1321458 + 64 NuclAT_21 - -
- 1321395..1321458 + 64 NuclAT_21 - -
- 1321395..1321458 + 64 NuclAT_21 - -
- 1321395..1321458 + 64 NuclAT_21 - -
- 1321395..1321458 + 64 NuclAT_22 - -
- 1321395..1321458 + 64 NuclAT_22 - -
- 1321395..1321458 + 64 NuclAT_22 - -
- 1321395..1321458 + 64 NuclAT_22 - -
- 1321395..1321458 + 64 NuclAT_23 - -
- 1321395..1321458 + 64 NuclAT_23 - -
- 1321395..1321458 + 64 NuclAT_23 - -
- 1321395..1321458 + 64 NuclAT_23 - -
MS7163_RS07010 1321748..1322848 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
MS7163_RS07015 1323118..1323348 + 231 WP_001146444.1 putative cation transport regulator ChaB -
MS7163_RS07020 1323506..1324201 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
MS7163_RS07025 1324245..1324598 - 354 WP_001169658.1 DsrE/F sulfur relay family protein YchN -
MS7163_RS07030 1324783..1326177 + 1395 WP_106919431.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T96481 WP_000170954.1 NZ_CP026853:c1321342-1321235 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T96481 NZ_CP026853:c1321342-1321235 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT96481 NZ_CP026853:1321395-1321456 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References