Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2973484..2973704 | Replicon | chromosome |
Accession | NZ_CP026846 | ||
Organism | Shigella boydii strain 59-2708 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | - |
Locus tag | C1P57_RS15055 | Protein ID | WP_078166279.1 |
Coordinates | 2973597..2973704 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2973484..2973550 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P57_RS15030 | 2968762..2970156 | - | 1395 | WP_024258159.1 | inverse autotransporter invasin YchO | - |
C1P57_RS15035 | 2970342..2970695 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
C1P57_RS15040 | 2970739..2971434 | - | 696 | WP_078166256.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C1P57_RS15045 | 2971592..2971822 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
C1P57_RS15050 | 2972092..2973192 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- | 2973484..2973550 | - | 67 | - | - | Antitoxin |
C1P57_RS15055 | 2973597..2973704 | + | 108 | WP_078166279.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
C1P57_RS15060 | 2973853..2974707 | - | 855 | WP_000811073.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C1P57_RS15065 | 2974743..2975552 | - | 810 | WP_078166257.1 | invasion regulator SirB1 | - |
C1P57_RS15070 | 2975556..2975948 | - | 393 | WP_000200382.1 | invasion regulator SirB2 | - |
C1P57_RS15075 | 2975945..2976777 | - | 833 | Protein_2924 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C1P57_RS15080 | 2976777..2977859 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.84 Da Isoelectric Point: 12.5163
>T96447 WP_078166279.1 NZ_CP026846:2973597-2973704 [Shigella boydii]
MTLAQFAMIFWHNLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T96447 NZ_CP026846:2973597-2973704 [Shigella boydii]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCATAACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCATAACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT96447 NZ_CP026846:c2973550-2973484 [Shigella boydii]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|