Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4002192..4002417 | Replicon | chromosome |
| Accession | NZ_CP026840 | ||
| Organism | Shigella dysenteriae strain ATCC 9753 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P67_RS20850 | Protein ID | WP_000813254.1 |
| Coordinates | 4002262..4002417 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4002192..4002250 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P67_RS20795 | 3997523..3997819 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
| C1P67_RS20800 | 3997816..3998277 | + | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
| C1P67_RS20805 | 3998255..3998611 | + | 357 | WP_000403782.1 | hypothetical protein | - |
| C1P67_RS20810 | 3998707..3998889 | + | 183 | WP_001224665.1 | hypothetical protein | - |
| C1P67_RS26775 | 3998882..3999058 | + | 177 | WP_000753053.1 | hypothetical protein | - |
| C1P67_RS20815 | 3999055..3999414 | + | 360 | WP_001289986.1 | hypothetical protein | - |
| C1P67_RS20820 | 3999415..3999630 | + | 216 | WP_000510387.1 | hypothetical protein | - |
| C1P67_RS20825 | 3999632..3999850 | + | 219 | WP_001142588.1 | DUF4014 family protein | - |
| C1P67_RS20830 | 3999852..4000115 | + | 264 | WP_000224215.1 | hypothetical protein | - |
| C1P67_RS20835 | 4000126..4000293 | + | 168 | WP_000207997.1 | hypothetical protein | - |
| C1P67_RS20840 | 4000494..4001722 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
| C1P67_RS20845 | 4001737..4001970 | + | 234 | WP_000350274.1 | hypothetical protein | - |
| - | 4002192..4002250 | - | 59 | - | - | Antitoxin |
| C1P67_RS20850 | 4002262..4002417 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P67_RS20855 | 4002634..4002885 | + | 252 | WP_000980988.1 | protein Rem | - |
| C1P67_RS27350 | 4002952..4003230 | + | 279 | WP_032336987.1 | hypothetical protein | - |
| C1P67_RS20865 | 4003232..4004278 | + | 1047 | WP_001265101.1 | DUF968 domain-containing protein | - |
| C1P67_RS20870 | 4004291..4004665 | + | 375 | WP_000904114.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P67_RS20875 | 4004662..4005483 | + | 822 | WP_000762933.1 | antitermination protein | - |
| C1P67_RS20880 | 4005710..4005950 | + | 241 | Protein_4020 | hypothetical protein | - |
| C1P67_RS20885 | 4006058..4007116 | + | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3983842..4040679 | 56837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96412 WP_000813254.1 NZ_CP026840:4002262-4002417 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96412 NZ_CP026840:4002262-4002417 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96412 NZ_CP026840:c4002250-4002192 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|