Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2750924..2751182 | Replicon | chromosome |
Accession | NZ_CP026840 | ||
Organism | Shigella dysenteriae strain ATCC 9753 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C1P67_RS14280 | Protein ID | WP_000809168.1 |
Coordinates | 2750924..2751076 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 2751125..2751182 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P67_RS14255 | 2746127..2746303 | - | 177 | Protein_2741 | DUF2541 family protein | - |
C1P67_RS14265 | 2747078..2747308 | - | 231 | Protein_2743 | DUF2541 family protein | - |
C1P67_RS14270 | 2747685..2749601 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
C1P67_RS14275 | 2749690..2750820 | + | 1131 | WP_001118467.1 | molecular chaperone DnaJ | - |
C1P67_RS14280 | 2750924..2751076 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 2751125..2751182 | + | 58 | - | - | Antitoxin |
C1P67_RS14285 | 2751662..2752828 | + | 1167 | WP_000681369.1 | Na+/H+ antiporter NhaA | - |
C1P67_RS14290 | 2752894..2753793 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
C1P67_RS14295 | 2753830..2754264 | - | 435 | Protein_2749 | fimbrial family protein | - |
C1P67_RS14300 | 2754355..2755583 | + | 1229 | WP_134805288.1 | IS3-like element IS2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2746326..2746829 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96409 WP_000809168.1 NZ_CP026840:c2751076-2750924 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96409 NZ_CP026840:c2751076-2750924 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96409 NZ_CP026840:2751125-2751182 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|