Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 102354..102579 | Replicon | chromosome |
| Accession | NZ_CP026840 | ||
| Organism | Shigella dysenteriae strain ATCC 9753 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P67_RS00620 | Protein ID | WP_000813254.1 |
| Coordinates | 102354..102509 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 102521..102579 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P67_RS00575 | 97428..98125 | + | 698 | WP_284520991.1 | IS1-like element IS1SD family transposase | - |
| C1P67_RS26590 | 98142..98444 | - | 303 | Protein_108 | phage tail protein | - |
| C1P67_RS00585 | 99121..99711 | - | 591 | Protein_109 | DUF2313 domain-containing protein | - |
| C1P67_RS00590 | 99711..99935 | - | 225 | WP_073691608.1 | hypothetical protein | - |
| C1P67_RS00595 | 99951..101107 | + | 1157 | WP_094096479.1 | IS3-like element IS600 family transposase | - |
| C1P67_RS00605 | 101157..101906 | - | 750 | Protein_112 | hypothetical protein | - |
| C1P67_RS00610 | 101908..102186 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P67_RS00620 | 102354..102509 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 102521..102579 | + | 59 | - | - | Antitoxin |
| C1P67_RS00635 | 103161..103577 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| C1P67_RS00640 | 103689..104069 | + | 381 | WP_001333468.1 | transposase | - |
| C1P67_RS00645 | 104066..104413 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P67_RS00650 | 104462..106000 | + | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
| C1P67_RS00655 | 106050..106505 | - | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
| C1P67_RS00660 | 106492..106797 | - | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
| C1P67_RS00665 | 106794..107216 | - | 423 | WP_001151146.1 | DUF977 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 71996..147930 | 75934 | |
| - | inside | IScluster/Tn | - | - | 97748..110262 | 12514 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96402 WP_000813254.1 NZ_CP026840:c102509-102354 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96402 NZ_CP026840:c102509-102354 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96402 NZ_CP026840:102521-102579 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|