Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2661214..2661439 | Replicon | chromosome |
| Accession | NZ_CP026839 | ||
| Organism | Shigella dysenteriae strain ATCC 9752 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P69_RS14450 | Protein ID | WP_000813254.1 |
| Coordinates | 2661214..2661369 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2661381..2661439 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P69_RS14415 | 2656265..2657323 | - | 1059 | WP_134803738.1 | site-specific DNA-methyltransferase | - |
| C1P69_RS14420 | 2657431..2657671 | - | 241 | Protein_2657 | hypothetical protein | - |
| C1P69_RS14425 | 2657883..2658571 | - | 689 | Protein_2658 | bacteriophage antitermination protein Q | - |
| C1P69_RS14430 | 2658568..2658909 | - | 342 | WP_134804226.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C1P69_RS14435 | 2658964..2659661 | + | 698 | WP_284526035.1 | IS1 family transposase | - |
| C1P69_RS14440 | 2659711..2660766 | - | 1056 | WP_134803739.1 | DUF968 domain-containing protein | - |
| C1P69_RS22855 | 2660768..2661046 | - | 279 | WP_158252698.1 | hypothetical protein | - |
| C1P69_RS14450 | 2661214..2661369 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2661381..2661439 | + | 59 | - | - | Antitoxin |
| C1P69_RS14455 | 2661593..2662584 | + | 992 | Protein_2664 | IS3 family transposase | - |
| C1P69_RS14465 | 2663831..2664058 | + | 228 | Protein_2666 | integrase core domain-containing protein | - |
| C1P69_RS14475 | 2664169..2664834 | - | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
| C1P69_RS14480 | 2665009..2665434 | - | 426 | Protein_2668 | DUF977 family protein | - |
| C1P69_RS14485 | 2665450..2666220 | - | 771 | WP_000451003.1 | DUF1627 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2620825..2679340 | 58515 | |
| - | inside | IScluster/Tn | - | - | 2659158..2672292 | 13134 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96395 WP_000813254.1 NZ_CP026839:c2661369-2661214 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96395 NZ_CP026839:c2661369-2661214 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96395 NZ_CP026839:2661381-2661439 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|