Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1912738..1912963 | Replicon | chromosome |
Accession | NZ_CP026839 | ||
Organism | Shigella dysenteriae strain ATCC 9752 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P69_RS10255 | Protein ID | WP_000813254.1 |
Coordinates | 1912808..1912963 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1912738..1912796 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P69_RS10205 | 1907836..1908261 | + | 426 | WP_000693847.1 | toxin YdaT family protein | - |
C1P69_RS10210 | 1908333..1908674 | + | 342 | WP_171765608.1 | hypothetical protein | - |
C1P69_RS10215 | 1908771..1909392 | + | 622 | Protein_1843 | phage replisome organizer | - |
C1P69_RS10220 | 1909426..1909848 | + | 423 | WP_001151146.1 | DUF977 family protein | - |
C1P69_RS10225 | 1909845..1910150 | + | 306 | WP_134803558.1 | DUF4406 domain-containing protein | - |
C1P69_RS23500 | 1910188..1910631 | + | 444 | WP_284526212.1 | ead/Ea22-like family protein | - |
C1P69_RS10235 | 1910513..1911725 | - | 1213 | Protein_1847 | IS3 family transposase | - |
C1P69_RS10240 | 1911784..1912041 | + | 258 | Protein_1848 | integrase core domain-containing protein | - |
- | 1912738..1912796 | - | 59 | - | - | Antitoxin |
C1P69_RS10255 | 1912808..1912963 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P69_RS10260 | 1913131..1913407 | + | 277 | Protein_1850 | hypothetical protein | - |
C1P69_RS10265 | 1913409..1914158 | + | 750 | Protein_1851 | hypothetical protein | - |
C1P69_RS10275 | 1914208..1914987 | - | 780 | Protein_1852 | IS3-like element IS600 family transposase | - |
C1P69_RS10285 | 1916300..1916676 | - | 377 | Protein_1854 | transposase | - |
C1P69_RS10290 | 1916742..1916876 | + | 135 | Protein_1855 | DUF1133 family protein | - |
C1P69_RS10315 | 1917669..1917851 | + | 183 | WP_134803559.1 | phage holin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH7.8 | 1891603..1939821 | 48218 | |
- | inside | IScluster/Tn | - | ipaH7.8 | 1902390..1925287 | 22897 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96393 WP_000813254.1 NZ_CP026839:1912808-1912963 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96393 NZ_CP026839:1912808-1912963 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96393 NZ_CP026839:c1912796-1912738 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|