Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1126876..1127134 | Replicon | chromosome |
Accession | NZ_CP026839 | ||
Organism | Shigella dysenteriae strain ATCC 9752 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C1P69_RS06375 | Protein ID | WP_000809168.1 |
Coordinates | 1126876..1127028 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 1127077..1127134 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P69_RS06355 | 1122233..1122830 | - | 598 | Protein_1089 | ubiquinol-cytochrome C chaperone family protein | - |
C1P69_RS06360 | 1122856..1123260 | - | 405 | WP_044067255.1 | DUF2541 family protein | - |
C1P69_RS06365 | 1123637..1125553 | + | 1917 | WP_023278178.1 | molecular chaperone DnaK | - |
C1P69_RS06370 | 1125642..1126772 | + | 1131 | WP_001118467.1 | molecular chaperone DnaJ | - |
C1P69_RS06375 | 1126876..1127028 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 1127077..1127134 | + | 58 | - | - | Antitoxin |
C1P69_RS06380 | 1127614..1128780 | + | 1167 | WP_134803351.1 | Na+/H+ antiporter NhaA | - |
C1P69_RS06385 | 1128846..1129745 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
C1P69_RS06390 | 1129783..1130256 | - | 474 | Protein_1096 | fimbrial family protein | - |
C1P69_RS06395 | 1130312..1131009 | + | 698 | WP_094106546.1 | IS1 family transposase | - |
C1P69_RS06400 | 1131243..1131506 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
C1P69_RS06405 | 1131609..1131827 | + | 219 | WP_001295417.1 | DUF2575 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1130506..1131009 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96391 WP_000809168.1 NZ_CP026839:c1127028-1126876 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96391 NZ_CP026839:c1127028-1126876 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96391 NZ_CP026839:1127077-1127134 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|