Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-ralA/- |
Location | 2538399..2538816 | Replicon | chromosome |
Accession | NZ_CP026836 | ||
Organism | Shigella boydii strain ATCC 49812 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | C1P56_RS13400 | Protein ID | WP_223200913.1 |
Coordinates | 2538694..2538816 (+) | Length | 41 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2538399..2538609 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P56_RS13360 | 2533866..2534723 | - | 858 | WP_000922456.1 | phosphatidate cytidylyltransferase | - |
C1P56_RS13365 | 2534736..2535494 | - | 759 | WP_004996908.1 | (2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase | - |
C1P56_RS13370 | 2535685..2537031 | - | 1347 | WP_004969946.1 | IS4-like element IS4 family transposase | - |
C1P56_RS13375 | 2537098..2537475 | + | 378 | Protein_2603 | IS66-like element accessory protein TnpA | - |
C1P56_RS13380 | 2537475..2537822 | + | 348 | WP_000622995.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P56_RS13385 | 2537886..2538128 | + | 243 | Protein_2605 | transposase | - |
C1P56_RS28510 | 2538112..2538210 | + | 99 | Protein_2606 | IS66 family insertion sequence element accessory protein TnpB | - |
- | 2538396..2538609 | + | 214 | NuclAT_8 | - | - |
- | 2538396..2538609 | + | 214 | NuclAT_8 | - | - |
- | 2538396..2538609 | + | 214 | NuclAT_8 | - | - |
- | 2538396..2538609 | + | 214 | NuclAT_8 | - | - |
- | 2538399..2538609 | - | 211 | - | - | Antitoxin |
C1P56_RS28515 | 2538597..2538749 | + | 153 | Protein_2607 | DUF5431 family protein | - |
C1P56_RS13400 | 2538694..2538816 | + | 123 | WP_223200913.1 | Hok/Gef family protein | Toxin |
C1P56_RS27870 | 2538909..2539073 | + | 165 | WP_004989787.1 | hypothetical protein | - |
C1P56_RS13410 | 2540871..2541005 | - | 135 | Protein_2611 | transposase | - |
C1P56_RS28520 | 2541005..2541109 | - | 105 | WP_075288148.1 | transposase domain-containing protein | - |
C1P56_RS28525 | 2541131..2541625 | - | 495 | Protein_2613 | IS66 family transposase | - |
C1P56_RS28530 | 2541565..2542464 | - | 900 | WP_284542724.1 | IS66 family transposase | - |
C1P56_RS13420 | 2542631..2542978 | - | 348 | WP_000631709.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P56_RS13425 | 2542975..2543649 | - | 675 | WP_001088287.1 | IS66-like element accessory protein TnpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 2535685..2545200 | 9515 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4538.38 Da Isoelectric Point: 8.2691
>T96380 WP_223200913.1 NZ_CP026836:2538694-2538816 [Shigella boydii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
>T96380 NZ_CP026836:2538694-2538816 [Shigella boydii]
ATCGTGTGCTGCACATTGTTGATATTCACACTCCTGACCCGGAATCGCCTGTGCGAAGTCCGGCTGAAGGACGGATACAG
GGAAGTTACGGCAACAATGGCTTACGAATCCGGCGGTAAGTAG
ATCGTGTGCTGCACATTGTTGATATTCACACTCCTGACCCGGAATCGCCTGTGCGAAGTCCGGCTGAAGGACGGATACAG
GGAAGTTACGGCAACAATGGCTTACGAATCCGGCGGTAAGTAG
Antitoxin
Download Length: 211 bp
>AT96380 NZ_CP026836:c2538609-2538399 [Shigella boydii]
GTGGACTAGACATGCAGAGGCCTCGTGGGTTAATGAAAATTAACTACGGGGCTTTTGTCCTTTGTCCTTCTGCCACACGA
CAGGATAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGCT
GACCACACTCACTTTCCCTGAAAATAATCTGGTCGTTCAGCCAGTTCACGG
GTGGACTAGACATGCAGAGGCCTCGTGGGTTAATGAAAATTAACTACGGGGCTTTTGTCCTTTGTCCTTCTGCCACACGA
CAGGATAACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGCT
GACCACACTCACTTTCCCTGAAAATAATCTGGTCGTTCAGCCAGTTCACGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|