Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 640992..641212 | Replicon | chromosome |
Accession | NZ_CP026836 | ||
Organism | Shigella boydii strain ATCC 49812 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | C1P56_RS03410 | Protein ID | WP_000170955.1 |
Coordinates | 640992..641099 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 641146..641212 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P56_RS03385 | 636836..637918 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
C1P56_RS03390 | 637918..638751 | + | 834 | WP_000386244.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C1P56_RS03395 | 638748..639140 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
C1P56_RS03400 | 639144..639953 | + | 810 | WP_001257048.1 | invasion regulator SirB1 | - |
C1P56_RS03405 | 639989..640843 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C1P56_RS03410 | 640992..641099 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 641146..641212 | + | 67 | - | - | Antitoxin |
C1P56_RS03415 | 641504..642604 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
C1P56_RS03420 | 642874..643104 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
C1P56_RS03425 | 643262..643957 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C1P56_RS03430 | 644001..644354 | - | 354 | WP_119172140.1 | DsrE/F sulfur relay family protein YchN | - |
C1P56_RS03435 | 644540..645934 | + | 1395 | WP_134796717.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T96365 WP_000170955.1 NZ_CP026836:c641099-640992 [Shigella boydii]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T96365 NZ_CP026836:c641099-640992 [Shigella boydii]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT96365 NZ_CP026836:641146-641212 [Shigella boydii]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|