Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3534382..3534640 | Replicon | chromosome |
Accession | NZ_CP026834 | ||
Organism | Shigella dysenteriae strain ATCC 49347 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C5B83_RS18550 | Protein ID | WP_000809168.1 |
Coordinates | 3534382..3534534 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3534583..3534640 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B83_RS18525 | 3529600..3529776 | - | 177 | Protein_3579 | DUF2541 family protein | - |
C5B83_RS18535 | 3530551..3530781 | - | 231 | Protein_3581 | DUF2541 family protein | - |
C5B83_RS18540 | 3531158..3533074 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
C5B83_RS18545 | 3533163..3534278 | + | 1116 | WP_001118451.1 | molecular chaperone DnaJ | - |
C5B83_RS18550 | 3534382..3534534 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3534583..3534640 | + | 58 | - | - | Antitoxin |
C5B83_RS18555 | 3535120..3536286 | + | 1167 | WP_000681373.1 | Na+/H+ antiporter NhaA | - |
C5B83_RS18560 | 3536352..3537251 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
C5B83_RS18565 | 3537289..3537723 | - | 435 | Protein_3587 | fimbrial family protein | - |
C5B83_RS18570 | 3537814..3539042 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3529799..3530302 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96354 WP_000809168.1 NZ_CP026834:c3534534-3534382 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96354 NZ_CP026834:c3534534-3534382 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96354 NZ_CP026834:3534583-3534640 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|