Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2582105..2582326 | Replicon | chromosome |
| Accession | NZ_CP026834 | ||
| Organism | Shigella dysenteriae strain ATCC 49347 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | C5B83_RS13810 | Protein ID | WP_001295224.1 |
| Coordinates | 2582219..2582326 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2582105..2582162 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5B83_RS13785 (2577545) | 2577545..2578447 | + | 903 | WP_000084671.1 | dipeptide ABC transporter permease DppC | - |
| C5B83_RS13790 (2578458) | 2578458..2579441 | + | 984 | WP_001196496.1 | dipeptide ABC transporter ATP-binding protein | - |
| C5B83_RS13795 (2579438) | 2579438..2580442 | + | 1005 | WP_000107017.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| C5B83_RS13800 (2580472) | 2580472..2581743 | - | 1272 | WP_005029350.1 | aromatic amino acid transport family protein | - |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2582105) | 2582105..2582162 | - | 58 | NuclAT_19 | - | Antitoxin |
| C5B83_RS13810 (2582219) | 2582219..2582326 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| C5B83_RS13815 (2582413) | 2582413..2583744 | - | 1332 | Protein_2679 | cellulose biosynthesis protein BcsG | - |
| C5B83_RS13820 (2583758) | 2583758..2585104 | - | 1347 | WP_005045922.1 | IS4-like element IS4 family transposase | - |
| C5B83_RS13825 (2585172) | 2585172..2585531 | - | 360 | Protein_2681 | cellulose biosynthesis protein BcsG | - |
| C5B83_RS13830 (2585528) | 2585528..2585719 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| C5B83_RS13835 (2585716) | 2585716..2587200 | - | 1485 | WP_001204959.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2583758..2585086 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T96353 WP_001295224.1 NZ_CP026834:2582219-2582326 [Shigella dysenteriae]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T96353 NZ_CP026834:2582219-2582326 [Shigella dysenteriae]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT96353 NZ_CP026834:c2582162-2582105 [Shigella dysenteriae]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
