Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2559720..2559977 | Replicon | chromosome |
Accession | NZ_CP026834 | ||
Organism | Shigella dysenteriae strain ATCC 49347 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | Q31V67 |
Locus tag | C5B83_RS13680 | Protein ID | WP_001135724.1 |
Coordinates | 2559825..2559977 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2559720..2559774 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B83_RS13650 | 2555229..2555459 | - | 231 | Protein_2649 | IS4 family transposase | - |
C5B83_RS13655 | 2555463..2555672 | - | 210 | Protein_2650 | IS66 family insertion sequence element accessory protein TnpB | - |
C5B83_RS13660 | 2555669..2556025 | - | 357 | WP_000239757.1 | transposase | - |
C5B83_RS13665 | 2556176..2557318 | + | 1143 | Protein_2652 | IS4-like element IS4 family transposase | - |
- | 2559720..2559774 | - | 55 | - | - | Antitoxin |
C5B83_RS13680 | 2559825..2559977 | + | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
C5B83_RS26070 | 2559966..2560025 | - | 60 | WP_212732943.1 | hypothetical protein | - |
C5B83_RS13685 | 2560156..2560368 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
C5B83_RS13690 | 2560649..2560939 | - | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
C5B83_RS13700 | 2562148..2562858 | + | 711 | WP_004987320.1 | DUF3053 domain-containing protein | - |
C5B83_RS13705 | 2562908..2563882 | - | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
C5B83_RS13710 | 2563986..2564573 | - | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 2555669..2561571 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96351 WP_001135724.1 NZ_CP026834:2559825-2559977 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96351 NZ_CP026834:2559825-2559977 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTAGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTAGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96351 NZ_CP026834:c2559774-2559720 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|