Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 895985..896210 | Replicon | chromosome |
Accession | NZ_CP026834 | ||
Organism | Shigella dysenteriae strain ATCC 49347 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C5B83_RS05055 | Protein ID | WP_000813254.1 |
Coordinates | 895985..896140 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 896152..896210 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B83_RS05015 | 891133..892401 | - | 1269 | Protein_977 | prophage tail fiber N-terminal domain-containing protein | - |
C5B83_RS05020 | 892425..892970 | - | 546 | WP_000902849.1 | tail fiber assembly protein | - |
C5B83_RS25915 | 892973..893041 | - | 69 | Protein_979 | phage tail protein | - |
C5B83_RS05025 | 893097..893794 | + | 698 | WP_134795416.1 | IS1-like element IS1SD family transposase | - |
C5B83_RS05030 | 893810..894738 | + | 929 | Protein_981 | IS3-like element IS600 family transposase | - |
C5B83_RS05040 | 894788..895537 | - | 750 | Protein_982 | hypothetical protein | - |
C5B83_RS05045 | 895539..895817 | - | 279 | WP_000929754.1 | hypothetical protein | - |
C5B83_RS05055 | 895985..896140 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 896152..896210 | + | 59 | - | - | Antitoxin |
C5B83_RS05070 | 896792..897208 | - | 417 | WP_005069274.1 | hypothetical protein | - |
C5B83_RS05075 | 897320..897700 | + | 381 | WP_001333468.1 | transposase | - |
C5B83_RS05080 | 897697..898044 | + | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C5B83_RS05085 | 898093..899631 | + | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
C5B83_RS05090 | 899681..900136 | - | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
C5B83_RS05095 | 900123..900428 | - | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
C5B83_RS05100 | 900425..900847 | - | 423 | WP_001151146.1 | DUF977 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 866272..919379 | 53107 | |
- | inside | IScluster/Tn | - | - | 893417..904658 | 11241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96344 WP_000813254.1 NZ_CP026834:c896140-895985 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96344 NZ_CP026834:c896140-895985 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96344 NZ_CP026834:896152-896210 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|