Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 101708..101933 | Replicon | chromosome |
Accession | NZ_CP026834 | ||
Organism | Shigella dysenteriae strain ATCC 49347 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C5B83_RS00565 | Protein ID | WP_000813254.1 |
Coordinates | 101778..101933 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 101708..101766 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B83_RS00510 | 97040..97336 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
C5B83_RS00515 | 97333..97794 | + | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
C5B83_RS00520 | 97772..98128 | + | 357 | WP_000403782.1 | hypothetical protein | - |
C5B83_RS00525 | 98224..98406 | + | 183 | WP_001224665.1 | hypothetical protein | - |
C5B83_RS25465 | 98399..98575 | + | 177 | WP_000753053.1 | hypothetical protein | - |
C5B83_RS00530 | 98572..98931 | + | 360 | WP_001289986.1 | hypothetical protein | - |
C5B83_RS00535 | 98932..99147 | + | 216 | WP_000510387.1 | hypothetical protein | - |
C5B83_RS00540 | 99149..99367 | + | 219 | WP_001142588.1 | DUF4014 family protein | - |
C5B83_RS00545 | 99369..99632 | + | 264 | WP_000224216.1 | hypothetical protein | - |
C5B83_RS00550 | 99643..99810 | + | 168 | WP_000207997.1 | hypothetical protein | - |
C5B83_RS00555 | 100010..101238 | + | 1229 | WP_167544911.1 | IS3-like element IS2 family transposase | - |
C5B83_RS00560 | 101223..101486 | + | 264 | WP_242412557.1 | hypothetical protein | - |
- | 101708..101766 | - | 59 | - | - | Antitoxin |
C5B83_RS00565 | 101778..101933 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C5B83_RS00570 | 102150..102401 | + | 252 | WP_000980988.1 | protein Rem | - |
C5B83_RS00575 | 102468..102746 | + | 279 | WP_032335658.1 | hypothetical protein | - |
C5B83_RS00580 | 102748..103794 | + | 1047 | WP_001265091.1 | DUF968 domain-containing protein | - |
C5B83_RS00585 | 103807..104181 | + | 375 | WP_073817556.1 | RusA family crossover junction endodeoxyribonuclease | - |
C5B83_RS00590 | 104178..104999 | + | 822 | WP_000762933.1 | antitermination protein | - |
C5B83_RS00595 | 105226..105466 | + | 241 | Protein_116 | hypothetical protein | - |
C5B83_RS00600 | 105574..106632 | + | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 83360..140464 | 57104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96334 WP_000813254.1 NZ_CP026834:101778-101933 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96334 NZ_CP026834:101778-101933 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96334 NZ_CP026834:c101766-101708 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|