Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokA/Ldr(toxin) |
| Location | 4395577..4395798 | Replicon | chromosome |
| Accession | NZ_CP026832 | ||
| Organism | Shigella dysenteriae strain ATCC 49346 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | C5B81_RS23165 | Protein ID | WP_001295224.1 |
| Coordinates | 4395691..4395798 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4395577..4395634 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5B81_RS23140 (4391017) | 4391017..4391919 | + | 903 | WP_000084671.1 | dipeptide ABC transporter permease DppC | - |
| C5B81_RS23145 (4391930) | 4391930..4392913 | + | 984 | WP_001196496.1 | dipeptide ABC transporter ATP-binding protein | - |
| C5B81_RS23150 (4392910) | 4392910..4393914 | + | 1005 | WP_000107017.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| C5B81_RS23155 (4393944) | 4393944..4395215 | - | 1272 | WP_119183788.1 | aromatic amino acid transport family protein | - |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (4395577) | 4395577..4395634 | - | 58 | NuclAT_19 | - | Antitoxin |
| C5B81_RS23165 (4395691) | 4395691..4395798 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| C5B81_RS23170 (4395885) | 4395885..4397216 | - | 1332 | Protein_4464 | cellulose biosynthesis protein BcsG | - |
| C5B81_RS23175 (4397230) | 4397230..4398575 | - | 1346 | Protein_4465 | IS4-like element IS4 family transposase | - |
| C5B81_RS23180 (4398643) | 4398643..4399002 | - | 360 | Protein_4466 | cellulose biosynthesis protein BcsG | - |
| C5B81_RS23185 (4398999) | 4398999..4399190 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| C5B81_RS23190 (4399187) | 4399187..4400671 | - | 1485 | WP_001204959.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4397442..4398557 | 1115 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T96329 WP_001295224.1 NZ_CP026832:4395691-4395798 [Shigella dysenteriae]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T96329 NZ_CP026832:4395691-4395798 [Shigella dysenteriae]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT96329 NZ_CP026832:c4395634-4395577 [Shigella dysenteriae]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
