Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4373194..4373451 | Replicon | chromosome |
Accession | NZ_CP026832 | ||
Organism | Shigella dysenteriae strain ATCC 49346 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | Q31V67 |
Locus tag | C5B81_RS23040 | Protein ID | WP_001135724.1 |
Coordinates | 4373299..4373451 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 4373194..4373248 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B81_RS23010 | 4368703..4368933 | - | 231 | Protein_4434 | IS4 family transposase | - |
C5B81_RS23015 | 4368937..4369146 | - | 210 | Protein_4435 | IS66 family insertion sequence element accessory protein TnpB | - |
C5B81_RS23020 | 4369143..4369499 | - | 357 | WP_000239757.1 | transposase | - |
C5B81_RS23025 | 4369650..4370792 | + | 1143 | Protein_4437 | IS4-like element IS4 family transposase | - |
- | 4373194..4373248 | - | 55 | - | - | Antitoxin |
C5B81_RS23040 | 4373299..4373451 | + | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
C5B81_RS26960 | 4373440..4373499 | - | 60 | WP_212732943.1 | hypothetical protein | - |
C5B81_RS23045 | 4373630..4373842 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
C5B81_RS23050 | 4374123..4374413 | - | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
C5B81_RS23060 | 4375622..4376332 | + | 711 | WP_004987320.1 | DUF3053 domain-containing protein | - |
C5B81_RS23065 | 4376382..4377356 | - | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
C5B81_RS23070 | 4377460..4378047 | - | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4369143..4375045 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96327 WP_001135724.1 NZ_CP026832:4373299-4373451 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96327 NZ_CP026832:4373299-4373451 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96327 NZ_CP026832:c4373248-4373194 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|