Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2756798..2757023 | Replicon | chromosome |
Accession | NZ_CP026832 | ||
Organism | Shigella dysenteriae strain ATCC 49346 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C5B81_RS14735 | Protein ID | WP_000813254.1 |
Coordinates | 2756798..2756953 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2756965..2757023 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B81_RS14695 | 2751946..2753214 | - | 1269 | Protein_2825 | prophage tail fiber N-terminal domain-containing protein | - |
C5B81_RS14700 | 2753238..2753783 | - | 546 | WP_000902849.1 | tail fiber assembly protein | - |
C5B81_RS26805 | 2753786..2753854 | - | 69 | Protein_2827 | phage tail protein | - |
C5B81_RS14705 | 2753910..2754607 | + | 698 | WP_252988931.1 | IS1-like element IS1SD family transposase | - |
C5B81_RS14710 | 2754623..2755551 | + | 929 | Protein_2829 | IS3-like element IS600 family transposase | - |
C5B81_RS14720 | 2755601..2756350 | - | 750 | Protein_2830 | hypothetical protein | - |
C5B81_RS14725 | 2756352..2756630 | - | 279 | WP_000929754.1 | hypothetical protein | - |
C5B81_RS14735 | 2756798..2756953 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2756965..2757023 | + | 59 | - | - | Antitoxin |
C5B81_RS14750 | 2757605..2758021 | - | 417 | WP_005069274.1 | hypothetical protein | - |
C5B81_RS14755 | 2758133..2758513 | + | 381 | WP_001333468.1 | transposase | - |
C5B81_RS14760 | 2758510..2758857 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C5B81_RS14765 | 2758906..2760444 | + | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
C5B81_RS14770 | 2760744..2761871 | - | 1128 | WP_001063816.1 | IS110-like element ISSso6 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2726548..2804518 | 77970 | |
- | inside | IScluster/Tn | - | - | 2754230..2768316 | 14086 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96320 WP_000813254.1 NZ_CP026832:c2756953-2756798 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96320 NZ_CP026832:c2756953-2756798 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96320 NZ_CP026832:2756965-2757023 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|