Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1977113..1977338 | Replicon | chromosome |
Accession | NZ_CP026832 | ||
Organism | Shigella dysenteriae strain ATCC 49346 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C5B81_RS10290 | Protein ID | WP_000813254.1 |
Coordinates | 1977183..1977338 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1977113..1977171 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5B81_RS10235 | 1972445..1972741 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
C5B81_RS10240 | 1972738..1973199 | + | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
C5B81_RS10245 | 1973177..1973533 | + | 357 | WP_000403782.1 | hypothetical protein | - |
C5B81_RS10250 | 1973629..1973811 | + | 183 | WP_001224665.1 | hypothetical protein | - |
C5B81_RS26115 | 1973804..1973980 | + | 177 | WP_000753053.1 | hypothetical protein | - |
C5B81_RS10255 | 1973977..1974336 | + | 360 | WP_001289986.1 | hypothetical protein | - |
C5B81_RS10260 | 1974337..1974552 | + | 216 | WP_000510389.1 | hypothetical protein | - |
C5B81_RS10265 | 1974554..1974772 | + | 219 | WP_001142588.1 | DUF4014 family protein | - |
C5B81_RS10270 | 1974774..1975037 | + | 264 | WP_000224216.1 | hypothetical protein | - |
C5B81_RS10275 | 1975048..1975215 | + | 168 | WP_000207997.1 | hypothetical protein | - |
C5B81_RS10280 | 1975415..1976643 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
C5B81_RS10285 | 1976628..1976891 | + | 264 | WP_242412557.1 | hypothetical protein | - |
- | 1977113..1977171 | - | 59 | - | - | Antitoxin |
C5B81_RS10290 | 1977183..1977338 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C5B81_RS10295 | 1977555..1977806 | + | 252 | WP_000980988.1 | protein Rem | - |
C5B81_RS10300 | 1977873..1978151 | + | 279 | WP_032335658.1 | hypothetical protein | - |
C5B81_RS10305 | 1978153..1979199 | + | 1047 | WP_001265091.1 | DUF968 domain-containing protein | - |
C5B81_RS10310 | 1979212..1979586 | + | 375 | WP_000904094.1 | RusA family crossover junction endodeoxyribonuclease | - |
C5B81_RS10315 | 1979583..1980404 | + | 822 | WP_000762933.1 | antitermination protein | - |
C5B81_RS10320 | 1980631..1980871 | + | 241 | Protein_1976 | hypothetical protein | - |
C5B81_RS10325 | 1980979..1982037 | + | 1059 | WP_134801094.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1944979..2015775 | 70796 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96310 WP_000813254.1 NZ_CP026832:1977183-1977338 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96310 NZ_CP026832:1977183-1977338 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96310 NZ_CP026832:c1977171-1977113 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|