Detailed information of TA system TA096295

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1802787..1803007
• Replicon: chromosome
• Accession: NZ_CP026831
• Organism: Shigella dysenteriae strain ATCC 12039

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: C1P71_RS10400
• Protein ID: WP_014639145.1
• Coordinates: 1802787..1802894 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1802941..1803007 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C1P71_RS10370	1798098..1799180	+	1083	WP_000804726.1	peptide chain release factor 1	-
C1P71_RS10375	1799180..1800013	+	834	WP_128880437.1	peptide chain release factor N(5)-glutamine methyltransferase	-
C1P71_RS10380	1800010..1800402	+	393	WP_000200387.1	invasion regulator SirB2	-
C1P71_RS10385	1800406..1801215	+	810	WP_001257044.1	invasion regulator SirB1	-
C1P71_RS10390	1801251..1802105	+	855	WP_000811052.1	3-deoxy-8-phosphooctulonate synthase	-
C1P71_RS10395	1802253..1802360	-	108	WP_128881609.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	1802408..1802474	+	67	NuclAT_37	-	-
-	1802408..1802474	+	67	NuclAT_37	-	-
-	1802408..1802474	+	67	NuclAT_37	-	-
-	1802408..1802474	+	67	NuclAT_37	-	-
-	1802408..1802474	+	67	NuclAT_39	-	-
-	1802408..1802474	+	67	NuclAT_39	-	-
-	1802408..1802474	+	67	NuclAT_39	-	-
-	1802408..1802474	+	67	NuclAT_39	-	-
-	1802408..1802474	+	67	NuclAT_41	-	-
-	1802408..1802474	+	67	NuclAT_41	-	-
-	1802408..1802474	+	67	NuclAT_41	-	-
-	1802408..1802474	+	67	NuclAT_41	-	-
-	1802410..1802473	+	64	NuclAT_14	-	-
-	1802410..1802473	+	64	NuclAT_14	-	-
-	1802410..1802473	+	64	NuclAT_14	-	-
-	1802410..1802473	+	64	NuclAT_14	-	-
-	1802410..1802473	+	64	NuclAT_16	-	-
-	1802410..1802473	+	64	NuclAT_16	-	-
-	1802410..1802473	+	64	NuclAT_16	-	-
-	1802410..1802473	+	64	NuclAT_16	-	-
-	1802410..1802473	+	64	NuclAT_18	-	-
-	1802410..1802473	+	64	NuclAT_18	-	-
-	1802410..1802473	+	64	NuclAT_18	-	-
-	1802410..1802473	+	64	NuclAT_18	-	-
-	1802410..1802473	+	64	NuclAT_20	-	-
-	1802410..1802473	+	64	NuclAT_20	-	-
-	1802410..1802473	+	64	NuclAT_20	-	-
-	1802410..1802473	+	64	NuclAT_20	-	-
-	1802410..1802473	+	64	NuclAT_22	-	-
-	1802410..1802473	+	64	NuclAT_22	-	-
-	1802410..1802473	+	64	NuclAT_22	-	-
-	1802410..1802473	+	64	NuclAT_22	-	-
-	1802410..1802473	+	64	NuclAT_24	-	-
-	1802410..1802473	+	64	NuclAT_24	-	-
-	1802410..1802473	+	64	NuclAT_24	-	-
-	1802410..1802473	+	64	NuclAT_24	-	-
-	1802410..1802475	+	66	NuclAT_26	-	-
-	1802410..1802475	+	66	NuclAT_26	-	-
-	1802410..1802475	+	66	NuclAT_26	-	-
-	1802410..1802475	+	66	NuclAT_26	-	-
-	1802410..1802475	+	66	NuclAT_28	-	-
-	1802410..1802475	+	66	NuclAT_28	-	-
-	1802410..1802475	+	66	NuclAT_28	-	-
-	1802410..1802475	+	66	NuclAT_28	-	-
-	1802410..1802475	+	66	NuclAT_30	-	-
-	1802410..1802475	+	66	NuclAT_30	-	-
-	1802410..1802475	+	66	NuclAT_30	-	-
-	1802410..1802475	+	66	NuclAT_30	-	-
-	1802410..1802475	+	66	NuclAT_32	-	-
-	1802410..1802475	+	66	NuclAT_32	-	-
-	1802410..1802475	+	66	NuclAT_32	-	-
-	1802410..1802475	+	66	NuclAT_32	-	-
-	1802410..1802475	+	66	NuclAT_34	-	-
-	1802410..1802475	+	66	NuclAT_34	-	-
-	1802410..1802475	+	66	NuclAT_34	-	-
-	1802410..1802475	+	66	NuclAT_34	-	-
-	1802410..1802475	+	66	NuclAT_36	-	-
-	1802410..1802475	+	66	NuclAT_36	-	-
-	1802410..1802475	+	66	NuclAT_36	-	-
-	1802410..1802475	+	66	NuclAT_36	-	-
C1P71_RS10400	1802787..1802894	-	108	WP_014639145.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1802941..1803007	+	67	-	-	Antitoxin
C1P71_RS10410	1803091..1804459	-	1369	Protein_1771	IS3-like element IS150 family transposase	-
C1P71_RS10415	1804746..1805846	-	1101	WP_128880438.1	sodium-potassium/proton antiporter ChaA	-
C1P71_RS10420	1806116..1806346	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
C1P71_RS10425	1806504..1807199	+	696	WP_128880439.1	glutathione-specific gamma-glutamylcyclotransferase	-
C1P71_RS10430	1807243..1807596	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4071.90 Da
• Isoelectric Point: 11.4779

>T96295 WP_014639145.1 NZ_CP026831:c1802894-1802787 [Shigella dysenteriae]
MTLAQFAMIFWHDLAAPILTGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T96295 NZ_CP026831:c1802894-1802787 [Shigella dysenteriae]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGACGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT96295 NZ_CP026831:1802941-1803007 [Shigella dysenteriae]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin