Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3450866..3451091 | Replicon | chromosome |
Accession | NZ_CP026828 | ||
Organism | Shigella dysenteriae strain ATCC 12037 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P70_RS18150 | Protein ID | WP_000813254.1 |
Coordinates | 3450866..3451021 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3451033..3451091 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P70_RS18115 | 3446166..3447224 | - | 1059 | WP_134807195.1 | site-specific DNA-methyltransferase | - |
C1P70_RS18120 | 3447333..3447573 | - | 241 | Protein_3493 | hypothetical protein | - |
C1P70_RS18125 | 3447800..3448621 | - | 822 | WP_000762933.1 | antitermination protein | - |
C1P70_RS18130 | 3448618..3448992 | - | 375 | WP_000904114.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P70_RS18135 | 3449005..3450051 | - | 1047 | WP_001265091.1 | DUF968 domain-containing protein | - |
C1P70_RS26840 | 3450053..3450331 | - | 279 | WP_134807196.1 | hypothetical protein | - |
C1P70_RS18145 | 3450398..3450649 | - | 252 | WP_000980988.1 | protein Rem | - |
C1P70_RS18150 | 3450866..3451021 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3451033..3451091 | + | 59 | - | - | Antitoxin |
C1P70_RS18155 | 3451313..3451576 | - | 264 | WP_242412557.1 | hypothetical protein | - |
C1P70_RS18165 | 3452990..3453157 | - | 168 | WP_000207997.1 | hypothetical protein | - |
C1P70_RS18170 | 3453225..3454381 | + | 1157 | WP_094110543.1 | IS3-like element IS600 family transposase | - |
C1P70_RS18175 | 3454427..3454909 | + | 483 | Protein_3504 | tyrosine-type recombinase/integrase | - |
C1P70_RS18180 | 3454955..3455593 | - | 639 | WP_000737224.1 | outer membrane protein OmpW | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3411558..3458029 | 46471 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96278 WP_000813254.1 NZ_CP026828:c3451021-3450866 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96278 NZ_CP026828:c3451021-3450866 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96278 NZ_CP026828:3451033-3451091 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|