Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2654391..2654616 | Replicon | chromosome |
| Accession | NZ_CP026828 | ||
| Organism | Shigella dysenteriae strain ATCC 12037 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P70_RS13640 | Protein ID | WP_000813254.1 |
| Coordinates | 2654461..2654616 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2654391..2654449 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P70_RS13590 | 2649398..2649703 | + | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
| C1P70_RS13595 | 2649690..2650145 | + | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
| C1P70_RS13600 | 2650195..2651732 | - | 1538 | Protein_2608 | IS66-like element ISEc22 family transposase | - |
| C1P70_RS13605 | 2651781..2652128 | - | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P70_RS13610 | 2652125..2652505 | - | 381 | WP_001333468.1 | transposase | - |
| C1P70_RS13615 | 2652617..2652865 | + | 249 | Protein_2611 | hypothetical protein | - |
| C1P70_RS13625 | 2653622..2653810 | + | 189 | WP_134807086.1 | hypothetical protein | - |
| - | 2654391..2654449 | - | 59 | - | - | Antitoxin |
| C1P70_RS13640 | 2654461..2654616 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P70_RS13650 | 2654784..2655062 | + | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P70_RS13655 | 2655064..2655813 | + | 750 | Protein_2616 | hypothetical protein | - |
| C1P70_RS13670 | 2657083..2657325 | - | 243 | Protein_2618 | response regulator | - |
| C1P70_RS13675 | 2657458..2657871 | + | 414 | WP_000920127.1 | hydroxyisourate hydrolase | - |
| C1P70_RS13680 | 2657980..2658980 | + | 1001 | Protein_2620 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
| C1P70_RS13685 | 2658981..2659616 | + | 636 | WP_001241113.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2610983..2692336 | 81353 | |
| - | inside | IScluster/Tn | - | - | 2645311..2668929 | 23618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96268 WP_000813254.1 NZ_CP026828:2654461-2654616 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96268 NZ_CP026828:2654461-2654616 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96268 NZ_CP026828:c2654449-2654391 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|