Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 616159..616416 | Replicon | chromosome |
| Accession | NZ_CP026828 | ||
| Organism | Shigella dysenteriae strain ATCC 12037 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | Q31V67 |
| Locus tag | C1P70_RS03215 | Protein ID | WP_001135724.1 |
| Coordinates | 616159..616311 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 616362..616416 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P70_RS03185 | 611563..612150 | + | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
| C1P70_RS03190 | 612254..613228 | + | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| C1P70_RS03195 | 613278..613988 | - | 711 | WP_004987320.1 | DUF3053 domain-containing protein | - |
| C1P70_RS03200 | 614245..614942 | + | 698 | WP_252988899.1 | IS1-like element IS1SD family transposase | - |
| C1P70_RS03205 | 615197..615487 | + | 291 | WP_004987407.1 | HTH-type transcriptional regulator | - |
| C1P70_RS03210 | 615768..615980 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| C1P70_RS26475 | 616111..616170 | + | 60 | WP_212732943.1 | hypothetical protein | - |
| C1P70_RS03215 | 616159..616311 | - | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 616362..616416 | + | 55 | - | - | Antitoxin |
| C1P70_RS03220 | 616575..617272 | + | 698 | WP_225322336.1 | IS1 family transposase | - |
| C1P70_RS03225 | 617576..618804 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
| C1P70_RS03230 | 618818..619960 | - | 1143 | Protein_630 | IS4 family transposase | - |
| C1P70_RS03235 | 620111..620467 | + | 357 | WP_000239757.1 | transposase | - |
| C1P70_RS03240 | 620464..620673 | + | 210 | Protein_632 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P70_RS03245 | 620677..620907 | + | 231 | Protein_633 | IS4 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 614565..620467 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96261 WP_001135724.1 NZ_CP026828:c616311-616159 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96261 NZ_CP026828:c616311-616159 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96261 NZ_CP026828:616362-616416 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|