Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4528550..4528808 | Replicon | chromosome |
Accession | NZ_CP026819 | ||
Organism | Shigella dysenteriae strain 96-265 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C1P77_RS24435 | Protein ID | WP_000809168.1 |
Coordinates | 4528550..4528702 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4528751..4528808 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P77_RS24410 | 4523768..4523944 | - | 177 | Protein_4608 | DUF2541 family protein | - |
C1P77_RS24420 | 4524719..4524949 | - | 231 | Protein_4610 | DUF2541 family protein | - |
C1P77_RS24425 | 4525326..4527242 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
C1P77_RS24430 | 4527331..4528446 | + | 1116 | WP_001118451.1 | molecular chaperone DnaJ | - |
C1P77_RS24435 | 4528550..4528702 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 4528751..4528808 | + | 58 | - | - | Antitoxin |
C1P77_RS24440 | 4529288..4530454 | + | 1167 | WP_000681373.1 | Na+/H+ antiporter NhaA | - |
C1P77_RS24445 | 4530520..4531419 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
C1P77_RS24450 | 4531457..4531891 | - | 435 | Protein_4616 | fimbrial family protein | - |
C1P77_RS24455 | 4531982..4532729 | + | 748 | Protein_4617 | IS3-like element IS2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4523967..4524470 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96227 WP_000809168.1 NZ_CP026819:c4528702-4528550 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96227 NZ_CP026819:c4528702-4528550 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96227 NZ_CP026819:4528751-4528808 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|