Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3532395..3532652 | Replicon | chromosome |
Accession | NZ_CP026819 | ||
Organism | Shigella dysenteriae strain 96-265 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | Q31V67 |
Locus tag | C1P77_RS19410 | Protein ID | WP_001135724.1 |
Coordinates | 3532500..3532652 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 3532395..3532449 (-) |
Genomic Context
Location: 3528851..3529993 (1143 bp)
Type: Others
Protein ID: Protein_3657
Type: Others
Protein ID: Protein_3657
Location: 3532500..3532652 (153 bp)
Type: Toxin
Protein ID: WP_001135724.1
Type: Toxin
Protein ID: WP_001135724.1
Location: 3534823..3535533 (711 bp)
Type: Others
Protein ID: WP_005045940.1
Type: Others
Protein ID: WP_005045940.1
Location: 3527904..3528134 (231 bp)
Type: Others
Protein ID: Protein_3654
Type: Others
Protein ID: Protein_3654
Location: 3528138..3528347 (210 bp)
Type: Others
Protein ID: Protein_3655
Type: Others
Protein ID: Protein_3655
Location: 3528344..3528700 (357 bp)
Type: Others
Protein ID: WP_000239757.1
Type: Others
Protein ID: WP_000239757.1
Location: 3532395..3532449 (55 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 3532641..3532700 (60 bp)
Type: Others
Protein ID: WP_212732943.1
Type: Others
Protein ID: WP_212732943.1
Location: 3532831..3533043 (213 bp)
Type: Others
Protein ID: WP_000014594.1
Type: Others
Protein ID: WP_000014594.1
Location: 3533324..3533614 (291 bp)
Type: Others
Protein ID: WP_005045913.1
Type: Others
Protein ID: WP_005045913.1
Location: 3535583..3536557 (975 bp)
Type: Others
Protein ID: WP_000805034.1
Type: Others
Protein ID: WP_000805034.1
Location: 3536661..3537248 (588 bp)
Type: Others
Protein ID: WP_000747616.1
Type: Others
Protein ID: WP_000747616.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P77_RS19380 | 3527904..3528134 | - | 231 | Protein_3654 | IS4 family transposase | - |
C1P77_RS19385 | 3528138..3528347 | - | 210 | Protein_3655 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P77_RS19390 | 3528344..3528700 | - | 357 | WP_000239757.1 | transposase | - |
C1P77_RS19395 | 3528851..3529993 | + | 1143 | Protein_3657 | IS4-like element IS4 family transposase | - |
- | 3532395..3532449 | - | 55 | - | - | Antitoxin |
C1P77_RS19410 | 3532500..3532652 | + | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
C1P77_RS27365 | 3532641..3532700 | - | 60 | WP_212732943.1 | hypothetical protein | - |
C1P77_RS19415 | 3532831..3533043 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
C1P77_RS19420 | 3533324..3533614 | - | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
C1P77_RS19430 | 3534823..3535533 | + | 711 | WP_005045940.1 | DUF3053 domain-containing protein | - |
C1P77_RS19435 | 3535583..3536557 | - | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
C1P77_RS19440 | 3536661..3537248 | - | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 3528344..3534246 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96224 WP_001135724.1 NZ_CP026819:3532500-3532652 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96224 NZ_CP026819:3532500-3532652 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96224 NZ_CP026819:c3532449-3532395 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q31V67 |