Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1105741..1105966 | Replicon | chromosome |
Accession | NZ_CP026819 | ||
Organism | Shigella dysenteriae strain 96-265 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P77_RS06545 | Protein ID | WP_000813254.1 |
Coordinates | 1105811..1105966 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1105741..1105799 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P77_RS06490 | 1101073..1101369 | + | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
C1P77_RS06495 | 1101366..1101827 | + | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
C1P77_RS06500 | 1101805..1102161 | + | 357 | WP_000403782.1 | hypothetical protein | - |
C1P77_RS06505 | 1102257..1102439 | + | 183 | WP_001224665.1 | hypothetical protein | - |
C1P77_RS27030 | 1102432..1102608 | + | 177 | WP_000753053.1 | hypothetical protein | - |
C1P77_RS06510 | 1102605..1102964 | + | 360 | WP_001289986.1 | hypothetical protein | - |
C1P77_RS06515 | 1102965..1103180 | + | 216 | WP_000510389.1 | hypothetical protein | - |
C1P77_RS06520 | 1103182..1103400 | + | 219 | WP_001142588.1 | DUF4014 family protein | - |
C1P77_RS06525 | 1103402..1103665 | + | 264 | WP_000224216.1 | hypothetical protein | - |
C1P77_RS06530 | 1103676..1103843 | + | 168 | WP_000207997.1 | hypothetical protein | - |
C1P77_RS06535 | 1104043..1105271 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
C1P77_RS06540 | 1105256..1105519 | + | 264 | WP_242412557.1 | hypothetical protein | - |
- | 1105741..1105799 | - | 59 | - | - | Antitoxin |
C1P77_RS06545 | 1105811..1105966 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P77_RS06550 | 1106183..1106434 | + | 252 | WP_000980988.1 | protein Rem | - |
C1P77_RS06555 | 1106501..1106779 | + | 279 | WP_032335658.1 | hypothetical protein | - |
C1P77_RS06560 | 1106781..1107827 | + | 1047 | WP_001265099.1 | DUF968 domain-containing protein | - |
C1P77_RS06565 | 1107840..1108214 | + | 375 | WP_000904094.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P77_RS06570 | 1108211..1109032 | + | 822 | WP_069661440.1 | antitermination protein | - |
C1P77_RS06575 | 1109259..1109499 | + | 241 | Protein_1164 | hypothetical protein | - |
C1P77_RS06580 | 1109607..1110665 | + | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1086615..1144499 | 57884 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96206 WP_000813254.1 NZ_CP026819:1105811-1105966 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96206 NZ_CP026819:1105811-1105966 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96206 NZ_CP026819:c1105799-1105741 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|