Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1754510..1754735 | Replicon | chromosome |
Accession | NZ_CP026815 | ||
Organism | Shigella dysenteriae strain 93-119 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P76_RS09030 | Protein ID | WP_000813254.1 |
Coordinates | 1754580..1754735 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1754510..1754568 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P76_RS08985 | 1749873..1750295 | + | 423 | WP_001151146.1 | DUF977 family protein | - |
C1P76_RS08990 | 1750292..1750597 | + | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
C1P76_RS08995 | 1750584..1751039 | + | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
C1P76_RS09000 | 1751089..1752627 | - | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
C1P76_RS09005 | 1752676..1753023 | - | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P76_RS09010 | 1753020..1753400 | - | 381 | WP_001333468.1 | transposase | - |
C1P76_RS09015 | 1753512..1753928 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 1754510..1754568 | - | 59 | - | - | Antitoxin |
C1P76_RS09030 | 1754580..1754735 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C1P76_RS09040 | 1754903..1755181 | + | 279 | WP_000929754.1 | hypothetical protein | - |
C1P76_RS09045 | 1755183..1755932 | + | 750 | Protein_1749 | hypothetical protein | - |
C1P76_RS09055 | 1755982..1756910 | - | 929 | Protein_1750 | IS3-like element IS600 family transposase | - |
C1P76_RS27610 | 1757679..1757747 | + | 69 | Protein_1752 | phage tail protein | - |
C1P76_RS09065 | 1757750..1758295 | + | 546 | WP_000902849.1 | tail fiber assembly protein | - |
C1P76_RS09070 | 1758319..1759587 | + | 1269 | Protein_1754 | prophage tail fiber N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 1721515..1787705 | 66190 | |
- | inside | IScluster/Tn | - | - | 1722172..1757303 | 35131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96183 WP_000813254.1 NZ_CP026815:1754580-1754735 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96183 NZ_CP026815:1754580-1754735 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96183 NZ_CP026815:c1754568-1754510 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|