Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 60725..60946 Replicon chromosome
Accession NZ_CP026815
Organism Shigella dysenteriae strain 93-119

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag C1P76_RS00245 Protein ID WP_001295224.1
Coordinates 60725..60832 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 60889..60946 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C1P76_RS00220 (55851) 55851..57335 + 1485 WP_001204959.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
C1P76_RS00225 (57332) 57332..57523 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
C1P76_RS00230 (57520) 57520..57879 + 360 Protein_44 cellulose biosynthesis protein BcsG -
C1P76_RS00235 (57947) 57947..59293 + 1347 WP_005045922.1 IS4-like element IS4 family transposase -
C1P76_RS00240 (59307) 59307..60638 + 1332 Protein_46 cellulose biosynthesis protein BcsG -
C1P76_RS00245 (60725) 60725..60832 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (60889) 60889..60946 + 58 NuclAT_14 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_14 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_14 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_14 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_19 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_19 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_19 - Antitoxin
- (60889) 60889..60946 + 58 NuclAT_19 - Antitoxin
C1P76_RS00255 (61307) 61307..62578 + 1272 WP_005029350.1 aromatic amino acid transport family protein -
C1P76_RS00260 (62608) 62608..63612 - 1005 WP_000107017.1 dipeptide ABC transporter ATP-binding subunit DppF -
C1P76_RS00265 (63609) 63609..64592 - 984 WP_001196496.1 dipeptide ABC transporter ATP-binding protein -
C1P76_RS00270 (64603) 64603..65505 - 903 WP_000084671.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 57965..59293 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T96171 WP_001295224.1 NZ_CP026815:c60832-60725 [Shigella dysenteriae]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T96171 NZ_CP026815:c60832-60725 [Shigella dysenteriae]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA

Antitoxin


Download         Length: 58 bp

>AT96171 NZ_CP026815:60889-60946 [Shigella dysenteriae]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References