Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3421402..3421627 | Replicon | chromosome |
| Accession | NZ_CP026814 | ||
| Organism | Shigella boydii strain 83-578 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P60_RS18530 | Protein ID | WP_000813254.1 |
| Coordinates | 3421402..3421557 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3421569..3421627 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P60_RS18495 | 3416570..3418107 | - | 1538 | Protein_3331 | IS66-like element ISEc22 family transposase | - |
| C1P60_RS18500 | 3418156..3418503 | - | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P60_RS18505 | 3418500..3418880 | - | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C1P60_RS18510 | 3419235..3420362 | - | 1128 | WP_001063816.1 | IS110-like element ISSso6 family transposase | - |
| C1P60_RS18515 | 3420493..3420954 | - | 462 | Protein_3335 | hypothetical protein | - |
| C1P60_RS18520 | 3420956..3421234 | - | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P60_RS18530 | 3421402..3421557 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3421569..3421627 | + | 59 | - | - | Antitoxin |
| C1P60_RS18545 | 3422209..3422651 | - | 443 | Protein_3338 | hypothetical protein | - |
| C1P60_RS18550 | 3422695..3423075 | + | 381 | WP_001333468.1 | IS66 family insertion sequence hypothetical protein | - |
| C1P60_RS18555 | 3423072..3423419 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P60_RS18560 | 3423468..3425006 | + | 1539 | WP_134802545.1 | IS66-like element ISEc22 family transposase | - |
| C1P60_RS18565 | 3425003..3425362 | + | 360 | WP_073692993.1 | 3'-5' exoribonuclease | - |
| C1P60_RS18570 | 3425421..3425624 | + | 204 | WP_000096344.1 | DUF4224 domain-containing protein | - |
| C1P60_RS18575 | 3425624..3425979 | + | 356 | Protein_3344 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 3412499..3440274 | 27775 | |
| - | inside | IScluster/Tn | - | - | 3414206..3427180 | 12974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96157 WP_000813254.1 NZ_CP026814:c3421557-3421402 [Shigella boydii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96157 NZ_CP026814:c3421557-3421402 [Shigella boydii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96157 NZ_CP026814:3421569-3421627 [Shigella boydii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|