Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 515923..516144 Replicon chromosome
Accession NZ_CP026811
Organism Shigella flexneri strain 64-5500

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag C1P83_RS02685 Protein ID WP_000170954.1
Coordinates 515923..516030 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 516078..516144 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C1P83_RS02660 (511767) 511767..512849 + 1083 WP_000804740.1 peptide chain release factor 1 -
C1P83_RS02665 (512849) 512849..513682 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C1P83_RS02670 (513679) 513679..514071 + 393 WP_000200378.1 invasion regulator SirB2 -
C1P83_RS02675 (514075) 514075..514884 + 810 WP_001257044.1 invasion regulator SirB1 -
C1P83_RS02680 (514920) 514920..515774 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C1P83_RS02685 (515923) 515923..516030 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (516078) 516078..516144 + 67 NuclAT_39 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_39 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_39 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_39 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_41 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_41 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_41 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_41 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_43 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_43 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_43 - Antitoxin
- (516078) 516078..516144 + 67 NuclAT_43 - Antitoxin
C1P83_RS02690 (516458) 516458..516565 - 108 WP_000170925.1 type I toxin-antitoxin system toxin Ldr family protein -
- (516618) 516618..516679 + 62 NuclAT_27 - -
- (516618) 516618..516679 + 62 NuclAT_27 - -
- (516618) 516618..516679 + 62 NuclAT_27 - -
- (516618) 516618..516679 + 62 NuclAT_27 - -
- (516618) 516618..516679 + 62 NuclAT_29 - -
- (516618) 516618..516679 + 62 NuclAT_29 - -
- (516618) 516618..516679 + 62 NuclAT_29 - -
- (516618) 516618..516679 + 62 NuclAT_29 - -
- (516618) 516618..516679 + 62 NuclAT_31 - -
- (516618) 516618..516679 + 62 NuclAT_31 - -
- (516618) 516618..516679 + 62 NuclAT_31 - -
- (516618) 516618..516679 + 62 NuclAT_31 - -
- (516618) 516618..516679 + 62 NuclAT_33 - -
- (516618) 516618..516679 + 62 NuclAT_33 - -
- (516618) 516618..516679 + 62 NuclAT_33 - -
- (516618) 516618..516679 + 62 NuclAT_33 - -
- (516618) 516618..516679 + 62 NuclAT_35 - -
- (516618) 516618..516679 + 62 NuclAT_35 - -
- (516618) 516618..516679 + 62 NuclAT_35 - -
- (516618) 516618..516679 + 62 NuclAT_35 - -
- (516618) 516618..516679 + 62 NuclAT_37 - -
- (516618) 516618..516679 + 62 NuclAT_37 - -
- (516618) 516618..516679 + 62 NuclAT_37 - -
- (516618) 516618..516679 + 62 NuclAT_37 - -
- (516618) 516618..516680 + 63 NuclAT_38 - -
- (516618) 516618..516680 + 63 NuclAT_38 - -
- (516618) 516618..516680 + 63 NuclAT_38 - -
- (516618) 516618..516680 + 63 NuclAT_38 - -
- (516618) 516618..516680 + 63 NuclAT_40 - -
- (516618) 516618..516680 + 63 NuclAT_40 - -
- (516618) 516618..516680 + 63 NuclAT_40 - -
- (516618) 516618..516680 + 63 NuclAT_40 - -
- (516618) 516618..516680 + 63 NuclAT_42 - -
- (516618) 516618..516680 + 63 NuclAT_42 - -
- (516618) 516618..516680 + 63 NuclAT_42 - -
- (516618) 516618..516680 + 63 NuclAT_42 - -
- (516618) 516618..516681 + 64 NuclAT_15 - -
- (516618) 516618..516681 + 64 NuclAT_15 - -
- (516618) 516618..516681 + 64 NuclAT_15 - -
- (516618) 516618..516681 + 64 NuclAT_15 - -
- (516618) 516618..516681 + 64 NuclAT_17 - -
- (516618) 516618..516681 + 64 NuclAT_17 - -
- (516618) 516618..516681 + 64 NuclAT_17 - -
- (516618) 516618..516681 + 64 NuclAT_17 - -
- (516618) 516618..516681 + 64 NuclAT_19 - -
- (516618) 516618..516681 + 64 NuclAT_19 - -
- (516618) 516618..516681 + 64 NuclAT_19 - -
- (516618) 516618..516681 + 64 NuclAT_19 - -
- (516618) 516618..516681 + 64 NuclAT_21 - -
- (516618) 516618..516681 + 64 NuclAT_21 - -
- (516618) 516618..516681 + 64 NuclAT_21 - -
- (516618) 516618..516681 + 64 NuclAT_21 - -
- (516618) 516618..516681 + 64 NuclAT_23 - -
- (516618) 516618..516681 + 64 NuclAT_23 - -
- (516618) 516618..516681 + 64 NuclAT_23 - -
- (516618) 516618..516681 + 64 NuclAT_23 - -
- (516618) 516618..516681 + 64 NuclAT_25 - -
- (516618) 516618..516681 + 64 NuclAT_25 - -
- (516618) 516618..516681 + 64 NuclAT_25 - -
- (516618) 516618..516681 + 64 NuclAT_25 - -
C1P83_RS02695 (516994) 516994..517101 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (517149) 517149..517214 + 66 NuclAT_26 - -
- (517149) 517149..517214 + 66 NuclAT_26 - -
- (517149) 517149..517214 + 66 NuclAT_26 - -
- (517149) 517149..517214 + 66 NuclAT_26 - -
- (517149) 517149..517214 + 66 NuclAT_28 - -
- (517149) 517149..517214 + 66 NuclAT_28 - -
- (517149) 517149..517214 + 66 NuclAT_28 - -
- (517149) 517149..517214 + 66 NuclAT_28 - -
- (517149) 517149..517214 + 66 NuclAT_30 - -
- (517149) 517149..517214 + 66 NuclAT_30 - -
- (517149) 517149..517214 + 66 NuclAT_30 - -
- (517149) 517149..517214 + 66 NuclAT_30 - -
- (517149) 517149..517214 + 66 NuclAT_32 - -
- (517149) 517149..517214 + 66 NuclAT_32 - -
- (517149) 517149..517214 + 66 NuclAT_32 - -
- (517149) 517149..517214 + 66 NuclAT_32 - -
- (517149) 517149..517214 + 66 NuclAT_34 - -
- (517149) 517149..517214 + 66 NuclAT_34 - -
- (517149) 517149..517214 + 66 NuclAT_34 - -
- (517149) 517149..517214 + 66 NuclAT_34 - -
- (517149) 517149..517214 + 66 NuclAT_36 - -
- (517149) 517149..517214 + 66 NuclAT_36 - -
- (517149) 517149..517214 + 66 NuclAT_36 - -
- (517149) 517149..517214 + 66 NuclAT_36 - -
- (517149) 517149..517216 + 68 NuclAT_14 - -
- (517149) 517149..517216 + 68 NuclAT_14 - -
- (517149) 517149..517216 + 68 NuclAT_14 - -
- (517149) 517149..517216 + 68 NuclAT_14 - -
- (517149) 517149..517216 + 68 NuclAT_16 - -
- (517149) 517149..517216 + 68 NuclAT_16 - -
- (517149) 517149..517216 + 68 NuclAT_16 - -
- (517149) 517149..517216 + 68 NuclAT_16 - -
- (517149) 517149..517216 + 68 NuclAT_18 - -
- (517149) 517149..517216 + 68 NuclAT_18 - -
- (517149) 517149..517216 + 68 NuclAT_18 - -
- (517149) 517149..517216 + 68 NuclAT_18 - -
- (517149) 517149..517216 + 68 NuclAT_20 - -
- (517149) 517149..517216 + 68 NuclAT_20 - -
- (517149) 517149..517216 + 68 NuclAT_20 - -
- (517149) 517149..517216 + 68 NuclAT_20 - -
- (517149) 517149..517216 + 68 NuclAT_22 - -
- (517149) 517149..517216 + 68 NuclAT_22 - -
- (517149) 517149..517216 + 68 NuclAT_22 - -
- (517149) 517149..517216 + 68 NuclAT_22 - -
- (517149) 517149..517216 + 68 NuclAT_24 - -
- (517149) 517149..517216 + 68 NuclAT_24 - -
- (517149) 517149..517216 + 68 NuclAT_24 - -
- (517149) 517149..517216 + 68 NuclAT_24 - -
C1P83_RS02700 (517506) 517506..518606 - 1101 WP_004984217.1 sodium-potassium/proton antiporter ChaA -
C1P83_RS02705 (518876) 518876..519106 + 231 WP_001146442.1 putative cation transport regulator ChaB -
C1P83_RS02710 (519264) 519264..519959 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C1P83_RS02715 (520003) 520003..520356 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T96131 WP_000170954.1 NZ_CP026811:c516030-515923 [Shigella flexneri]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T96131 NZ_CP026811:c516030-515923 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT96131 NZ_CP026811:516078-516144 [Shigella flexneri]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References