Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 515923..516144 | Replicon | chromosome |
| Accession | NZ_CP026811 | ||
| Organism | Shigella flexneri strain 64-5500 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | C1P83_RS02685 | Protein ID | WP_000170954.1 |
| Coordinates | 515923..516030 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 516078..516144 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P83_RS02660 (511767) | 511767..512849 | + | 1083 | WP_000804740.1 | peptide chain release factor 1 | - |
| C1P83_RS02665 (512849) | 512849..513682 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| C1P83_RS02670 (513679) | 513679..514071 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| C1P83_RS02675 (514075) | 514075..514884 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| C1P83_RS02680 (514920) | 514920..515774 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| C1P83_RS02685 (515923) | 515923..516030 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_39 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_39 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_39 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_39 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_41 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_41 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_41 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_41 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (516078) | 516078..516144 | + | 67 | NuclAT_43 | - | Antitoxin |
| C1P83_RS02690 (516458) | 516458..516565 | - | 108 | WP_000170925.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_27 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_27 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_27 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_27 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_29 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_29 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_29 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_29 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_31 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_31 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_31 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_31 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_33 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_33 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_33 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_33 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_35 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_35 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_35 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_35 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_37 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_37 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_37 | - | - |
| - (516618) | 516618..516679 | + | 62 | NuclAT_37 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_38 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_38 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_38 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_38 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_40 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_40 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_40 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_40 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_42 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_42 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_42 | - | - |
| - (516618) | 516618..516680 | + | 63 | NuclAT_42 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_15 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_15 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_15 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_15 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_17 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_17 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_17 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_17 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_19 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_19 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_19 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_19 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_21 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_21 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_21 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_21 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_23 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_23 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_23 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_23 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_25 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_25 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_25 | - | - |
| - (516618) | 516618..516681 | + | 64 | NuclAT_25 | - | - |
| C1P83_RS02695 (516994) | 516994..517101 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_26 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_26 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_26 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_26 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_28 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_28 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_28 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_28 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_30 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_30 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_30 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_30 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_32 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_32 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_32 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_32 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_34 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_34 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_34 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_34 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_36 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_36 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_36 | - | - |
| - (517149) | 517149..517214 | + | 66 | NuclAT_36 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_14 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_14 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_14 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_14 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_16 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_16 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_16 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_16 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_18 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_18 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_18 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_18 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_20 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_20 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_20 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_20 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_22 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_22 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_22 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_22 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_24 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_24 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_24 | - | - |
| - (517149) | 517149..517216 | + | 68 | NuclAT_24 | - | - |
| C1P83_RS02700 (517506) | 517506..518606 | - | 1101 | WP_004984217.1 | sodium-potassium/proton antiporter ChaA | - |
| C1P83_RS02705 (518876) | 518876..519106 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| C1P83_RS02710 (519264) | 519264..519959 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| C1P83_RS02715 (520003) | 520003..520356 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T96131 WP_000170954.1 NZ_CP026811:c516030-515923 [Shigella flexneri]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T96131 NZ_CP026811:c516030-515923 [Shigella flexneri]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT96131 NZ_CP026811:516078-516144 [Shigella flexneri]
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTATTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|