Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3834141..3834398 | Replicon | chromosome |
Accession | NZ_CP026807 | ||
Organism | Shigella dysenteriae strain 204/96 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | Q31V67 |
Locus tag | C1P75_RS20300 | Protein ID | WP_001135724.1 |
Coordinates | 3834141..3834293 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 3834344..3834398 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P75_RS20270 | 3829545..3830132 | + | 588 | WP_000747616.1 | OmpA family lipoprotein | - |
C1P75_RS20275 | 3830236..3831210 | + | 975 | WP_000805034.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
C1P75_RS20280 | 3831260..3831970 | - | 711 | WP_005045940.1 | DUF3053 domain-containing protein | - |
C1P75_RS20285 | 3832227..3832924 | + | 698 | WP_134795416.1 | IS1-like element IS1SD family transposase | - |
C1P75_RS20290 | 3833179..3833469 | + | 291 | WP_005045913.1 | HTH-type transcriptional regulator | - |
C1P75_RS20295 | 3833750..3833962 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
C1P75_RS27950 | 3834093..3834152 | + | 60 | WP_212732943.1 | hypothetical protein | - |
C1P75_RS20300 | 3834141..3834293 | - | 153 | WP_001135724.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 3834344..3834398 | + | 55 | - | - | Antitoxin |
C1P75_RS20305 | 3834557..3835254 | + | 698 | WP_094106546.1 | IS1 family transposase | - |
C1P75_RS20310 | 3835558..3836786 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
C1P75_RS20315 | 3836800..3837942 | - | 1143 | Protein_3903 | IS4-like element IS4 family transposase | - |
C1P75_RS20320 | 3838093..3838449 | + | 357 | WP_000239757.1 | transposase | - |
C1P75_RS20325 | 3838446..3838655 | + | 210 | Protein_3905 | IS66 family insertion sequence element accessory protein TnpB | - |
C1P75_RS20330 | 3838659..3838889 | + | 231 | Protein_3906 | IS4 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 3832547..3838449 | 5902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5868.09 Da Isoelectric Point: 7.7173
>T96120 WP_001135724.1 NZ_CP026807:c3834293-3834141 [Shigella dysenteriae]
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
MPQKYGLLSLIVICFTLLFFTWMVRDSLCELHIKQGRYELAAFLACNLKE
Download Length: 153 bp
>T96120 NZ_CP026807:c3834293-3834141 [Shigella dysenteriae]
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAAAAATACGGATTACTTTCATTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGGTAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGCGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT96120 NZ_CP026807:3834344-3834398 [Shigella dysenteriae]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|