Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2836921..2837179 | Replicon | chromosome |
Accession | NZ_CP026807 | ||
Organism | Shigella dysenteriae strain 204/96 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C1P75_RS15255 | Protein ID | WP_000809168.1 |
Coordinates | 2837027..2837179 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 2836921..2836978 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P75_RS15235 | 2832318..2832752 | + | 435 | Protein_2941 | fimbrial family protein | - |
C1P75_RS15240 | 2832790..2833689 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
C1P75_RS15245 | 2833755..2834921 | - | 1167 | WP_000681373.1 | Na+/H+ antiporter NhaA | - |
C1P75_RS15250 | 2835204..2836331 | + | 1128 | WP_001063816.1 | IS110-like element ISSso6 family transposase | - |
- | 2836921..2836978 | - | 58 | - | - | Antitoxin |
C1P75_RS15255 | 2837027..2837179 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
C1P75_RS15260 | 2837283..2838398 | - | 1116 | WP_001118451.1 | molecular chaperone DnaJ | - |
C1P75_RS15265 | 2838487..2840403 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
C1P75_RS15270 | 2840780..2841010 | + | 231 | Protein_2948 | DUF2541 family protein | - |
C1P75_RS15275 | 2841065..2841762 | + | 698 | WP_237161507.1 | IS1 family transposase | - |
C1P75_RS15280 | 2841785..2841961 | + | 177 | Protein_2950 | DUF2541 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 2828855..2841762 | 12907 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96118 WP_000809168.1 NZ_CP026807:2837027-2837179 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96118 NZ_CP026807:2837027-2837179 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96118 NZ_CP026807:c2836978-2836921 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|