Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1514866..1515091 | Replicon | chromosome |
Accession | NZ_CP026807 | ||
Organism | Shigella dysenteriae strain 204/96 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C1P75_RS08220 | Protein ID | WP_000813254.1 |
Coordinates | 1514866..1515021 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1515033..1515091 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P75_RS08185 | 1510167..1511225 | - | 1059 | WP_000935541.1 | site-specific DNA-methyltransferase | - |
C1P75_RS08190 | 1511333..1511573 | - | 241 | Protein_1592 | hypothetical protein | - |
C1P75_RS08195 | 1511800..1512621 | - | 822 | WP_069661440.1 | antitermination protein | - |
C1P75_RS08200 | 1512618..1512992 | - | 375 | WP_000904094.1 | RusA family crossover junction endodeoxyribonuclease | - |
C1P75_RS08205 | 1513005..1514051 | - | 1047 | WP_001265099.1 | DUF968 domain-containing protein | - |
C1P75_RS08210 | 1514053..1514331 | - | 279 | WP_032335658.1 | hypothetical protein | - |
C1P75_RS08215 | 1514398..1514649 | - | 252 | WP_000980988.1 | protein Rem | - |
C1P75_RS08220 | 1514866..1515021 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 1515033..1515091 | + | 59 | - | - | Antitoxin |
C1P75_RS08225 | 1515313..1515546 | - | 234 | WP_000350274.1 | hypothetical protein | - |
C1P75_RS08235 | 1516989..1517156 | - | 168 | WP_000207997.1 | hypothetical protein | - |
C1P75_RS08240 | 1517167..1517430 | - | 264 | WP_000224216.1 | hypothetical protein | - |
C1P75_RS08245 | 1517432..1517650 | - | 219 | WP_001142588.1 | DUF4014 family protein | - |
C1P75_RS08250 | 1517652..1517867 | - | 216 | WP_000510389.1 | hypothetical protein | - |
C1P75_RS08255 | 1517868..1518227 | - | 360 | WP_001289986.1 | hypothetical protein | - |
C1P75_RS27675 | 1518224..1518400 | - | 177 | WP_000753053.1 | hypothetical protein | - |
C1P75_RS08260 | 1518393..1518575 | - | 183 | WP_001224665.1 | hypothetical protein | - |
C1P75_RS08265 | 1518671..1519027 | - | 357 | WP_000403782.1 | hypothetical protein | - |
C1P75_RS08270 | 1519005..1519466 | - | 462 | WP_001209470.1 | sigma-E factor regulatory protein RseB domain-containing protein | - |
C1P75_RS08275 | 1519463..1519759 | - | 297 | WP_001266130.1 | DUF4406 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | galU | 1476333..1558035 | 81702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96114 WP_000813254.1 NZ_CP026807:c1515021-1514866 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96114 NZ_CP026807:c1515021-1514866 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96114 NZ_CP026807:1515033-1515091 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|