Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 705551..705776 | Replicon | chromosome |
| Accession | NZ_CP026807 | ||
| Organism | Shigella dysenteriae strain 204/96 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C1P75_RS03640 | Protein ID | WP_000813254.1 |
| Coordinates | 705621..705776 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 705551..705609 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P75_RS03595 | 700914..701336 | + | 423 | WP_001151146.1 | DUF977 family protein | - |
| C1P75_RS03600 | 701333..701638 | + | 306 | WP_001266147.1 | DUF4406 domain-containing protein | - |
| C1P75_RS03605 | 701625..702080 | + | 456 | WP_000335375.1 | ead/Ea22-like family protein | - |
| C1P75_RS03610 | 702130..703668 | - | 1539 | WP_000099181.1 | IS66-like element ISEc22 family transposase | - |
| C1P75_RS03615 | 703717..704064 | - | 348 | WP_000612610.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| C1P75_RS03620 | 704061..704441 | - | 381 | WP_001333468.1 | transposase | - |
| C1P75_RS03625 | 704553..704969 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 705551..705609 | - | 59 | - | - | Antitoxin |
| C1P75_RS03640 | 705621..705776 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C1P75_RS03650 | 705944..706222 | + | 279 | WP_000929754.1 | hypothetical protein | - |
| C1P75_RS03655 | 706224..706973 | + | 750 | Protein_700 | hypothetical protein | - |
| C1P75_RS03665 | 707023..707951 | - | 929 | Protein_701 | IS3-like element IS600 family transposase | - |
| C1P75_RS27475 | 708720..708788 | + | 69 | Protein_703 | phage tail protein | - |
| C1P75_RS03675 | 708791..709336 | + | 546 | WP_000902849.1 | tail fiber assembly protein | - |
| C1P75_RS03680 | 709360..710629 | + | 1270 | Protein_705 | prophage tail fiber N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 660176..735006 | 74830 | |
| - | inside | IScluster/Tn | - | - | 673210..708344 | 35134 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T96104 WP_000813254.1 NZ_CP026807:705621-705776 [Shigella dysenteriae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T96104 NZ_CP026807:705621-705776 [Shigella dysenteriae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT96104 NZ_CP026807:c705609-705551 [Shigella dysenteriae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|