Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3654711..3654969 | Replicon | chromosome |
Accession | NZ_CP026805 | ||
Organism | Shigella dysenteriae strain 2017C-4522 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | C1P73_RS19330 | Protein ID | WP_000809168.1 |
Coordinates | 3654711..3654863 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3654912..3654969 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1P73_RS19305 | 3649929..3650105 | - | 177 | Protein_3719 | DUF2541 family protein | - |
C1P73_RS19315 | 3650880..3651110 | - | 231 | Protein_3721 | DUF2541 family protein | - |
C1P73_RS19320 | 3651487..3653403 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
C1P73_RS19325 | 3653492..3654607 | + | 1116 | WP_001118451.1 | molecular chaperone DnaJ | - |
C1P73_RS19330 | 3654711..3654863 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3654912..3654969 | + | 58 | - | - | Antitoxin |
C1P73_RS19335 | 3655559..3656686 | - | 1128 | WP_001063816.1 | IS110-like element ISSso6 family transposase | - |
C1P73_RS19340 | 3656969..3658135 | + | 1167 | WP_000681373.1 | Na+/H+ antiporter NhaA | - |
C1P73_RS19345 | 3658201..3659100 | + | 900 | WP_171765938.1 | transcriptional activator NhaR | - |
C1P73_RS19350 | 3659138..3659377 | - | 240 | Protein_3728 | fimbrial family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 3650128..3663036 | 12908 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T96097 WP_000809168.1 NZ_CP026805:c3654863-3654711 [Shigella dysenteriae]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T96097 NZ_CP026805:c3654863-3654711 [Shigella dysenteriae]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT96097 NZ_CP026805:3654912-3654969 [Shigella dysenteriae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|