Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2718541..2718762 | Replicon | chromosome |
| Accession | NZ_CP026805 | ||
| Organism | Shigella dysenteriae strain 2017C-4522 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | C1P73_RS14650 | Protein ID | WP_001295224.1 |
| Coordinates | 2718655..2718762 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2718541..2718598 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1P73_RS14625 (2713981) | 2713981..2714883 | + | 903 | WP_000084671.1 | dipeptide ABC transporter permease DppC | - |
| C1P73_RS14630 (2714894) | 2714894..2715877 | + | 984 | WP_001196496.1 | dipeptide ABC transporter ATP-binding protein | - |
| C1P73_RS14635 (2715874) | 2715874..2716878 | + | 1005 | WP_000107017.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| C1P73_RS14640 (2716908) | 2716908..2718179 | - | 1272 | WP_005029350.1 | aromatic amino acid transport family protein | - |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_14 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_19 | - | Antitoxin |
| - (2718541) | 2718541..2718598 | - | 58 | NuclAT_19 | - | Antitoxin |
| C1P73_RS14650 (2718655) | 2718655..2718762 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| C1P73_RS14655 (2718849) | 2718849..2720180 | - | 1332 | Protein_2835 | cellulose biosynthesis protein BcsG | - |
| C1P73_RS14660 (2720194) | 2720194..2721539 | - | 1346 | Protein_2836 | IS4-like element IS4 family transposase | - |
| C1P73_RS14665 (2721607) | 2721607..2721966 | - | 360 | Protein_2837 | cellulose biosynthesis protein BcsG | - |
| C1P73_RS14670 (2721963) | 2721963..2722154 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| C1P73_RS14675 (2722151) | 2722151..2723635 | - | 1485 | WP_001204959.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2720194..2721366 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T96096 WP_001295224.1 NZ_CP026805:2718655-2718762 [Shigella dysenteriae]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T96096 NZ_CP026805:2718655-2718762 [Shigella dysenteriae]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT96096 NZ_CP026805:c2718598-2718541 [Shigella dysenteriae]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
